KEGG   Rippkaea orientalis PCC 8802: Cyan8802_1233Help
Entry
Cyan8802_1233     CDS       T00968                                 

Definition
(GenBank) oxidoreductase domain protein
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00860  Porphyrin and chlorophyll metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cyan8802_1233
Enzymes [BR:cyh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     Cyan8802_1233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA NAD_binding_3 Semialdhyde_dh F420_oxidored NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ACV00158
Position
complement(1253448..1254476)
Genome map
AA seq 342 aa AA seqDB search
MIVNYNTLKMISTTPKLFLSRPLNIGIIGTGYAAQRRAETLLKDERSRLCYVSGHTPENL
ANFCQTYHTSPCDSWEALINYPDLDLVVICNINRDHGAIARRALEAGKHVIIEYPLALNF
SEASEILALATQKNLLLHIEHIEILGGMHQTTRQYLPQLGNVFYGRYTTIQPVRPVPRRW
TFHREMFGFPFMAALPRIHRFTDLFGEVKSVLCHDRFWDAPDIGYYTAFLCHATLGFKSG
LKVDLVYGKGDAFWQSDRTFELYGDRGTLIFKEETGTLITQEGEKTLELESRRGLFAQDT
QMVLDHLFEGKPLYIDPKSSLYALKIAEAADQSSQLGQLIKV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgattgttaattacaatacattaaaaatgatttctactacccctaaattatttctatcg
cgtcccttaaacatcggtattattggcacaggatacgctgctcaaagacgggctgaaaca
ttgcttaaagatgagcgatcgcggctatgctatgtgagtgggcataccccagaaaaccta
gccaacttttgccaaacctatcatacctccccttgtgactcttgggaagccttaatcaat
tatccagaccttgatctcgtggtgatttgtaacattaaccgagatcatggtgcgatcgcg
cgtcgtgccctagaagcgggaaagcacgttattatagaatatcctctagccctcaatttc
tctgaagcttcggaaatattggctttagcgactcaaaaaaacctactactccacatcgaa
catattgagattttagggggaatgcaccaaacaacccgtcagtatttaccccaattaggc
aatgttttctatggacgttataccaccattcaacccgtccgtcccgttccccgtcgttgg
acatttcaccgagagatgtttggctttccttttatggcagcattaccgcgtattcatcgc
tttactgacctatttggggaagtcaaaagcgtcttgtgtcatgatcgtttttgggatgcg
ccagacatcggatattataccgcttttttgtgtcatgccaccttaggatttaagagtggg
ttaaaggtagacttagtgtatggcaagggagacgcattttggcaaagcgatcgcaccttt
gaattatacggcgatcgcgggactttaatttttaaggaggaaaccgggacattaatcacc
caagaaggcgaaaaaacccttgaattagagagtcgtcgcggattatttgcccaagatacc
caaatggttttagatcatttattcgagggaaaacccctatatattgacccgaaatcgagt
ctttatgccctaaaaattgctgaagcggctgatcaatctagtcaattaggacaactcatt
aaagtttga

DBGET integrated database retrieval system