KEGG   Cyanothece sp. PCC 8802: Cyan8802_1776Help
Entry
Cyan8802_1776     CDS       T00968                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh00260  Glycine, serine and threonine metabolism
cyh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01130  Biosynthesis of antibiotics
cyh01230  Biosynthesis of amino acids
Module
cyh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan8802_1776
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyan8802_1776
Enzymes [BR:cyh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cyan8802_1776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF3708
Motif
Other DBs
NCBI-ProteinID: ACV00676
Position
1806562..1807803
Genome map
AA seq 413 aa AA seqDB search
MTTTPISPKTTTQTEYPDALGRFGRYGGKYVPETLMPALSELETAYSRYKDDPDFQQELN
QLLRDYVGRPSPLYFAERLTARYARPDGSGPQIYLKREDLNHTGAHKINNALGQVLLAKR
MGKQRIIAETGAGQHGVATATVCARFGLECVIYMGVHDMERQKLNVFRMKLLGATVQPVA
AGTGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHHVIGQETRRQSLEKW
GVLPDILLACIGGGSNAMGLFYEFVKDSTVRLIGVEAAGESIASGKHAATLTKGRPGVLH
GAMSYLLQDEEGQVIEAHSISAGLDYPGVGPEHSYLKDSGRAEYYSVTDAEAIAAFQRLS
QLEGIIPALETSHAIAYLETLCPQLDGSPRIIINCSGRGDKDVQTVAKYLGNE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccacccctatttccccaaaaaccactacacaaaccgaatatcccgacgcttta
ggacgttttggccgctatgggggaaaatacgtccccgaaaccctaatgccggccttaagt
gagctagaaaccgcctacagtcgctacaaagatgaccccgactttcaacaggaattaaac
caattattgcgggactatgtgggtcgtcccagtcccctgtactttgcagaacgcttaacc
gcccgttatgcccgtcctgatggcagtggtccgcaaatttacctgaaacgggaagattta
aaccatacgggagcccataaaatcaataacgccctcggacaggttcttttagccaaacgc
atgggcaaacagcgcattatcgcagaaacgggagcaggtcaacacggagtcgctactgcc
acagtttgtgctcgttttggactagaatgcgtcatttatatgggtgttcatgacatggaa
cgccaaaaattaaacgtttttcgcatgaaactcctcggtgctactgttcaacccgttgca
gcaggaacaggaaccctgaaagatgccacttcagaagctatccgagactgggtaacgaat
gttgagacgacccattatatcctagggtctgtagcgggtccccatccctatcccatgatg
gtcagagactttcatcacgttattgggcaagaaactcgccgtcaaagtctcgaaaaatgg
ggcgttttacccgatattctcctcgcttgtattggaggagggtcgaatgccatgggactg
ttttatgagtttgttaaagatagtactgttcgcttaattggggtagaagcagccggagaa
agcattgcttcaggaaaacacgctgctaccctgacaaaaggtcgtcctggggttttgcat
ggggcaatgagttatctcttgcaggatgaggaaggtcaggtcatcgaagcccattctatc
agtgccgggttagattatcctggggtgggacctgaacatagttaccttaaagatagtggc
cgcgcagaatattatagtgtgacggatgctgaagcaatcgcggcgtttcaacggttatcc
caattagaaggaattattcccgcgttagaaacctctcatgcgatcgcctatttagaaacc
ctttgtccgcaattagacggaagtcctcgcattattattaattgttcgggacggggggat
aaagatgttcaaaccgtggcgaaatatttgggcaatgaataa

DBGET integrated database retrieval system