KEGG   Cyanothece sp. PCC 8802: Cyan8802_2499Help
Entry
Cyan8802_2499     CDS       T00968                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh00010  Glycolysis / Gluconeogenesis
cyh00051  Fructose and mannose metabolism
cyh00562  Inositol phosphate metabolism
cyh00710  Carbon fixation in photosynthetic organisms
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01130  Biosynthesis of antibiotics
cyh01200  Carbon metabolism
cyh01230  Biosynthesis of amino acids
Module
cyh_M00002  Glycolysis, core module involving three-carbon compounds
cyh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan8802_2499
   00051 Fructose and mannose metabolism
    Cyan8802_2499
   00562 Inositol phosphate metabolism
    Cyan8802_2499
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan8802_2499
Enzymes [BR:cyh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cyan8802_2499
Exosome [BR:cyh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cyan8802_2499
  Exosomal proteins of bladder cancer cells
   Cyan8802_2499
  Exosomal proteins of melanoma cells
   Cyan8802_2499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACV01366
Position
2524306..2524998
Genome map
AA seq 230 aa AA seqDB search
MHKTQAEALEFLQVLKLELEEADETRGVVLCAPFTALGTMSKSLHGGLIRLGAQNIHWED
SGAYTGEIAGAMLTEIGVEYVVVGHSERRQYFGETDETANLRVIAAQRHGLTPILCVGET
KSQRDAGETETVIINQVKRGLVDVDQRNLVIAYEPIWAIGTGDTCEASEANRVIGLIREQ
LTNKAVTIQYGGSVKPDNIDEIMAQPEIDGALVGGASLDPVGFARIVNYQ
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaacacaggccgaagctctggagtttttgcaagtcttgaaattagagctagaa
gaagctgacgaaacgagaggagtggttctctgtgctccgtttactgccttgggaaccatg
tcaaaaagcttacatggtggcttaattcgtttgggagcccaaaatatccattgggaagat
agcggagcctacacaggagaaattgcgggggcgatgttgacagaaatcggggtagaatat
gtggtggttggccacagtgaacgtcgccagtatttcggagaaacggatgaaacagcgaat
ttacgggtgattgcagcgcaacgccatggcttaacccccattctctgtgtgggggaaacc
aagtctcaacgggatgccggggaaacagaaacagtgattattaatcaggttaagcgcggt
ttggtggatgtagaccagcgtaatttagtgatcgcttatgaacccatctgggcgatcggg
actggtgatacctgtgaagcctccgaagctaaccgagtcattggacttattcgagaacaa
ctgaccaataaagcggtaacaattcaatatggaggttccgtcaaacccgacaatattgat
gagattatggcacagccagagattgatggagctttggtgggtggagcgagtttagatcca
gtggggtttgctcgaattgtgaattatcaataa

DBGET integrated database retrieval system