KEGG   Rippkaea orientalis PCC 8802: Cyan8802_3405Help
Entry
Cyan8802_3405     CDS       T00968                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00900  Terpenoid backbone biosynthesis
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01130  Biosynthesis of antibiotics
Module
cyh_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cyan8802_3405
Enzymes [BR:cyh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Cyan8802_3405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh NAD_binding_3 DapB_N
Motif
Other DBs
NCBI-ProteinID: ACV02233
Position
3475664..3476860
Genome map
AA seq 398 aa AA seqDB search
MKKITILGSTGSIGTQTLDIVQQYPDQFQVVGLATRNNGELLAQQIKQFRPEIVAICQES
QLNTIKDAIASLDYSPILLTGEAGVVEVARYGDSESVVTGIVGCAGLLPTIAAIEAGKDI
ALANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPKGGLRRIILTASGGAF
RDWPVEQLKFVTVEDAIKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGLEYDKIDIVI
HPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTDWEPLDLVKAGSFTFREP
DHHKYPCMQLAYAAGRSGGAIPAVLNAANEQAVALFLEEKIAFLEIPKLIEMACDRFTNQ
NTSTPTLEDILEADRWARQEVIKGSQEIAKGNKIMSLT
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaaatcactatcctcggttccactgggtctattggtacacaaaccctcgatatt
gtccagcaataccctgatcaatttcaagtcgtgggtttagccactcgcaataatggggaa
ctgctggcacaacaaattaaacagtttcgacccgaaatcgtggctatttgtcaggaaagc
caattaaataccattaaagatgcgatcgcatccctagattattctcccatattactcacg
ggagaagccggagtcgttgaagtggcacgctatggagactcagaaagcgttgttacagga
attgtcggatgtgcggggttattaccgacgatagcagccattgaagccggaaaagatatt
gccttagctaacaaagaaaccttgattgccggggggcctgtcgtattaccgttagtcgag
aaacatggggttaaattactcccggcggactcggaacattcggctatttttcaatgctta
caaggggttcccaagggaggactacgccgtattattttaaccgcatcggggggagctttt
cgagattggccggtggaacaattaaagtttgttaccgttgaagatgccattaaacatccc
aattggtccatgggacgcaaaataaccgtggattctgctaccttaatgaataagggatta
gaagtcattgaagcccattatttgtttggcttagagtacgataaaattgatattgttatc
catcctcaaagtattattcactcgttaattgaattacaagatacttccgttttagcgcaa
ttgggatggccagatatgcgtcttcctctattatatgctttgtcgtggccggaaagaatt
tatactgattgggagcctttagatttagtgaaagcaggaagttttaccttccgagaaccc
gatcatcataaatatccttgtatgcaattagcctacgctgcgggacggtctgggggtgct
attccggcggtattaaatgcagctaatgaacaagcagtagcgttatttttagaagaaaaa
attgcctttttagaaattcctaaattgattgaaatggcttgcgatcgctttacgaatcaa
aatacttcaactccgactttagaagatattttagaagcagatcgttgggcaaggcaagaa
gtcattaaaggttctcaagaaatagccaaaggtaataaaattatgtctctcacctaa

DBGET integrated database retrieval system