KEGG   Cyanothece sp. PCC 8802: Cyan8802_3625Help
Entry
Cyan8802_3625     CDS       T00968                                 

Definition
(GenBank) periplasmic solute binding protein
  KO
K09818  manganese/iron transport system substrate-binding protein
Organism
cyh  Cyanothece sp. PCC 8802
Module
cyh_M00243  Manganese/iron transport system
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyh02000]
    Cyan8802_3625
Transporters [BR:cyh02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/iron transporter [MD:M00243]
    Cyan8802_3625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZnuA NanE DUF2634
Motif
Other DBs
NCBI-ProteinID: ACV02441
Position
3698760..3699740
Genome map
AA seq 326 aa AA seqDB search
MMEKKINRGGISRFLSKLLVFGVIFGMGMTGCQSPNASTGDNDKPKVVSTSTIIANLTEE
IAKNEVDHQGILEPGADPHVYEPVPTDSVAFEEADLILYNGYNLEPGLIKLMKASGIKAK
KVAVAEVVTPLDYVYKGQKEPDPHVWGDGKNVIKMVEVIRDELIQLSPEDASIFKQNAAI
LITELERLDGWIIEQIKTIPEAQRKLVTTHDAFQYYAKAYGLEVIGTLIGISTEEQPSAQ
TVKNLTEEIKKSKVPSIFAETTINPALITTVAQEAGVKLAPNPLYADSIGTAGSEGDSYV
KMLRANTKTIVEALGGQAQVIDTPSP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaaaaaaattaatagaggaggaatatctcggtttttatctaaattgctggtt
tttggggtaattttcggtatggggatgaccgggtgtcagtcccccaatgcttcgacgggg
gataacgataaacccaaagtcgtctctaccagtaccattattgccaatttaaccgaagaa
attgccaaaaacgaggtggatcatcaagggatcttagaaccaggggctgatccccatgtt
tatgaacctgtcccgactgatagcgtggcttttgaagaagcggatctcattttgtataac
ggttataatcttgaacctgggttaattaaattgatgaaagcgtcaggaattaaagcaaaa
aaagttgctgttgctgaggttgttacgccattagattatgtctataagggacaaaaagaa
cccgatcctcatgtttggggagatgggaaaaatgtgattaaaatggtggaagtaattcgg
gatgaattaatccaattatcaccagaagatgcgtcaatttttaaacaaaatgcagcgata
ttaattaccgagttagaacgtcttgatggttggattattgaacaaattaaaaccattcct
gaagcacaacgtaagttagtaacaacccatgatgcttttcaatattatgctaaagcctat
gggttagaggtaatcgggacattaattggcattagtacggaagaacagccgagtgctcaa
acggttaaaaatttaacagaagagattaaaaaaagcaaggttccgtcgatttttgccgaa
acaacgattaatcctgctttaattaccacagttgcccaagaagcaggggttaaacttgcc
cctaaccccctgtatgcagattccattggaactgctggaagcgagggagatagttatgtt
aaaatgctgcgggctaatactaagacaattgtagaggctttaggcgggcaagctcaagtt
attgacactccctcgccgtag

DBGET integrated database retrieval system