KEGG   Cyanothece sp. PCC 8802: Cyan8802_3658Help
Entry
Cyan8802_3658     CDS       T00968                                 

Definition
(GenBank) hypothetical protein
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACV02471
Position
complement(3732239..3732490)
Genome map
AA seq 83 aa AA seqDB search
MNSANLPLKSSQIVQVPWNDRWTVYHRLQELGISCYCSSNQPLEVQLSSPTAVIQLWSVV
KHCSSSRQELIQWLQTCWDLKKT
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgaattccgcaaacctccccctaaaatccagtcaaatcgtgcaagttccttggaacgat
cgctggactgtttatcaccgccttcaagaattagggatttcctgttattgctcaagcaat
caacccctagaagttcagctttcaagtcctactgctgtgattcagctttggagtgtggtc
aaacactgttcgtcctcccgtcaagagttgatccaatggctacagacttgttgggactta
aagaagacttaa

DBGET integrated database retrieval system