KEGG   Cyanothece sp. PCC 8802: Cyan8802_3662Help
Entry
Cyan8802_3662     CDS       T00968                                 

Definition
(GenBank) cobalamin biosynthesis protein CobW
  KO
K02234  cobalamin biosynthesis protein CobW
Organism
cyh  Cyanothece sp. PCC 8802
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cyan8802_3662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cobW CobW_C AAA_22 RsgA_GTPase AAA_16 AAA_33 TsaE Viral_helicase1 MobB AAA_18 AAA_28 ATPase_2 AAA_14 ABC_tran NACHT AAA_PrkA
Motif
Other DBs
NCBI-ProteinID: ACV02474
Position
complement(3734064..3735095)
Genome map
AA seq 343 aa AA seqDB search
MHKIPVTVITGFLGAGKTTLVRHLLQNNQKRRIAVLVNEFGEVGIDGELLRDCQICDEDE
IPNNNIIELTNGCLCCTVQEEFFPTMQQLLERRDSLDCMLIETSGLALPKPLVQAFRWPE
IRNGATVDGVVTVVDTQALASGTLVGDLTALEAQRQADPNLEHETPIEELFEDQLACADL
VLLTKTDLIAPSQLTQIEDWLKQELRPGVKVIPCHNGVISPDILLGFNAAVEDNLDSRPS
HHDEEEEHDHDNDINSVQVILDQEFEPKALIEKLKTLVETTEIYRIKGFVNVANKPMRLV
LQGVGDRFDTYYDRLWKPDELRQTRLVFIGRQLTLENIKAKLH
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaatccccgttacagtgattactggatttctaggcgcaggtaaaacaacccta
gttcgccatcttttacaaaacaatcaaaaacgccgtattgctgtcttagttaatgaattt
ggagaagtaggaattgatggggaattgctgcgagattgtcaaatttgtgatgaagacgaa
atcccaaataataacattattgaattgacaaatggctgtctttgttgtaccgttcaagag
gagtttttccccacaatgcagcaactcttagaaagacgagatagcctagattgtatgtta
attgaaacctctgggttagccttaccaaaacctttggttcaggccttccgttggccagaa
attcgcaatggtgcgactgttgatggagtggtcacagtagttgatactcaggccttagct
tcggggacgttagtaggagatttaaccgctttagaagcgcaaagacaggccgatcccaac
ctagaacatgaaacccccatcgaagaattatttgaggatcaattagcttgtgctgactta
gttttattaaccaaaactgatttaattgcaccctctcaattaactcaaattgaagactgg
ttaaagcaagaattacgacccggagtaaaagttattccttgccataatggtgtcattagt
ccagatattttattagggtttaatgctgccgttgaagacaatttagatagccgtcctagt
catcacgatgaagaagaagaacacgatcatgataatgatattaactctgttcaagttatt
cttgaccaagaatttgaaccaaaagcattaattgaaaaactcaaaactttagttgaaaca
acagagatttatcgcataaaaggctttgttaatgttgctaataaacccatgcggttagtc
ttacaaggagttggcgatcgctttgatacctattatgatcgcttgtggaaacccgacgaa
cttcgtcaaacccgtttagtatttattggtcgtcagttaaccttagaaaacattaaagct
aaacttcattaa

DBGET integrated database retrieval system