KEGG   Cyanothece sp. PCC 8802: Cyan8802_3669Help
Entry
Cyan8802_3669     CDS       T00968                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
Organism
cyh  Cyanothece sp. PCC 8802
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SCP2_2 Acetyltransf_9 Acetyltransf_7 Acetyltransf_1 Acetyltransf_10 FR47 Acetyltransf_CG Acetyltransf_13
Motif
Other DBs
NCBI-ProteinID: ACV02481
Position
3743957..3745135
Genome map
AA seq 392 aa AA seqDB search
MTFSLNYSSLRHPEDEQQIKKLISQCFAEFLTESETYFNRIGSQNFRILHHNDQVIAGLA
IYFMGQWYGENLIPMAGIAAVGVAPEHRGKGVAFQLLSHTLEELYHSGYPISVLYPATQV
LYRKVGYEQGGSYCLWELPTDTIQISEKNLPITSISPINYEQFEAIYQQQARKNNGNLDR
NFAIWQKTLEVQGKQESYAYLIGEKNQPEGYVIFTQEKGSNGLHLILKDWGLLTPNSVKH
FWAFIAAHRSLVSQVEWKSSPIDSTLLSLSEQTAKIKYQKRWMLRVVNVPLALSKRGYPQ
GIETELHLEITDDIIVANNGKFCLRVSQGCGEVTPGGKCNFRLNIRGLASLYTGLFTPIQ
LQLLGYLDATPDAIEAATIIFSGSTPWMPDFF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacattctcccttaactacagttctctgcgtcatcctgaagacgaacaacaaattaaa
aaactaatcagtcaatgttttgcggaatttctgacagaatcagaaacttattttaatcgt
attggtagccaaaattttcgtattcttcatcacaatgatcaagtaattgcgggtttagct
atttattttatgggacaatggtatggagaaaatcttatcccaatggctggtattgctgcc
gtaggagttgcaccagaacatcgtggaaaaggagttgcattccaacttttgagtcatacc
ttagaggaactttatcactcaggatatcccatttctgtcctctatccagcgactcaagtt
ctttatcgcaaagttggatatgaacaagggggaagttattgtctttgggagttacctact
gatacaattcaaatttcagagaagaatctccctattacgtctatttctcctattaattat
gaacaatttgaagcaatttatcaacaacaagctagaaaaaataatggtaatttagatcgc
aattttgctatttggcaaaaaaccctagaagtgcaaggtaaacaagagagctatgcttat
cttattggagagaaaaatcaacccgaaggttatgttattttcactcaagaaaaaggcagt
aatggattacatttaatcctcaaagattggggattattaactcctaattcagttaaacat
ttttgggcgtttattgctgctcatcgttccttagttagtcaagtagagtggaaaagttcc
cccattgattcaacgctattatcattatctgaacaaacggctaaaatcaagtatcaaaaa
cgttggatgttaagagttgttaatgtgcctttagccttatcaaaacgaggctatcctcaa
gggatagaaacagaattacacctagaaatcactgatgatattatagttgcgaataatggt
aaattttgcttgcgcgtttcccaaggatgcggggaagtaacccctggaggaaaatgcaat
tttcgcctcaatatacggggtttagcttccctttatacaggtttatttaccccaattcaa
cttcagttattaggttatcttgacgcaacaccagacgctattgaagctgctacaattatt
ttctcaggttctactccttggatgccagattttttctaa

DBGET integrated database retrieval system