KEGG   Cyanothece sp. PCC 8802: Cyan8802_3678Help
Entry
Cyan8802_3678     CDS       T00968                                 

Definition
(GenBank) protein of unknown function DUF21
  KO
K03699  putative hemolysin
Organism
cyh  Cyanothece sp. PCC 8802
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:cyh02042]
    Cyan8802_3678
Bacterial toxins [BR:cyh02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Other
   Cyan8802_3678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF21 CorC_HlyC CBS DUF502 GPHR_N
Motif
Other DBs
NCBI-ProteinID: ACV02490
Position
3756714..3758045
Genome map
AA seq 443 aa AA seqDB search
MSAIATEIIFILLLIIANGIFSGSEMAIVSSRKVRLEQLASRGNRQARTVLNLINAPNNF
LSTVQIGITLIGILSGAIAGATLAERLTAIFQRIPLLKAYSQGISVGIVVGVITFLSLVM
GELVPKRIALNAPEKIACAVAQPMKLLSRFAAPIVNLLSASTDFLLKLLGIKVSDEPAVT
EEEIKVLIRQGADLGLFEESEHEMVERVFRLGDRSVKSLMTPRKEIVWLDIESPLAENLQ
EVIDSGYSRFPVGRGSLDQYMGVVRGNSLLAACLSNQEVDLESFLQQPLYIAENTRALNV
LEQFKQTGIHTALVIDEYGGIEGLVTLDDVVEAILGELPSAEDLEAPMAVQREDGSWLLD
GLLAIDDFKELFSDLPLPEISSQQYHTLGGFMMYSLKRIPQASEYFEWGRLRLEVVDMDG
TRVDKVLVTVLDNAPEDEPINEE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgatcgccaccgaaattatttttattcttctgctgattatcgccaatgggatc
ttttctggttcagagatggctatcgtctcctctcgtaaagtccgtttagaacaactggct
agtcgaggcaatcgtcaggcaagaacggtactaaatctcatcaatgccccgaataacttc
ctctctaccgtacaaattgggattaccctgattgggattctcagtggtgcaatagccgga
gcaaccctagctgaacgattaacggcgatcttccaaaggattcctctattaaaagcttac
agtcaaggtattagtgtcggtattgtcgtcggggtgattacctttctttccttagtgatg
ggcgaattagtccccaaacgcatcgccctcaatgcacctgaaaaaattgcttgtgcagtg
gcacaaccgatgaaactgctctcgcgttttgcagcccctatcgtcaatttattgagtgcc
tcgacggattttttactaaaattattggggattaaagtttccgatgaaccagccgtaaca
gaagaggaaattaaggtactcattcgtcaaggggctgatttggggttatttgaggagtct
gaacacgaaatggtagaacgggtatttcgtctaggcgatcgctccgttaaatccctgatg
accccccgtaaagagatagtttggctcgatatcgagtcacccttagcggagaatttgcaa
gaggttatcgatagtggctattcacgttttcctgtgggacgggggagtttagatcaatac
atgggggtagttcgaggaaacagtctgttagctgcttgtctgtcgaaccaggaggttgat
ctcgaatcttttctacaacaacccctctatattgctgaaaatactcgcgcattaaacgtc
ctagaacagtttaagcaaacaggcatccatacagccctggtaatcgatgaatacggcgga
attgagggcttagtgacccttgatgatgtggtagaggcgattttaggtgaattaccctcg
gccgaggatcttgaggctcccatggcggttcaacgggaagatggttcctggttgttggat
gggttactggcgatcgatgattttaaagagcttttctcagatctgccacttccggaaatt
tcctctcaacagtaccataccctcggcggtttcatgatgtattctctcaagcgcatcccc
caagcaagtgagtattttgagtggggaaggttacgcttggaagtggtagatatggatgga
acacgagtcgataaggtattagtgacggttctcgacaatgctcccgaagatgaaccgatt
aacgaggagtag

DBGET integrated database retrieval system