KEGG   Cyanothece sp. PCC 8802: Cyan8802_3689Help
Entry
Cyan8802_3689     CDS       T00968                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01130  Biosynthesis of antibiotics
cyh01230  Biosynthesis of amino acids
Module
cyh_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyan8802_3689
Enzymes [BR:cyh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Cyan8802_3689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 NeuB PEP_mutase Amidohydro_1 IGPS
Motif
Other DBs
NCBI-ProteinID: ACV02501
Position
3767813..3768664
Genome map
AA seq 283 aa AA seqDB search
MFNAQLALKSNPEAITLVSLTDTVVFGGQDIVMIGGPCAVESLAQMEAVANGLSLAPVQA
LRGGAFKPRTSPHSFQGLGLEGLKILAEVKRRYGIPVVTEVMSTEQIEAVATYADMLQVG
SRNMQNFELLKALGHVNKPILLKRGLAATLEEFIGAAEYILSHGNTQVVLCERGIRSFDN
YTRNVLDLGAVVALKQLTCLPVIVDPSHAAGRRELIAPLAKAAIAAGADGLIIECHPQPE
KSVSDAAQALSLEEMVSLVHSLQPIAQAIGRSIVPFSRSLIAA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacgctcaactcgccctaaaatccaatcctgaagccattacccttgtttcttta
acggatactgtcgttttcggcggtcaagatatcgtaatgattggtggcccctgtgcggtg
gaaagtttggcacaaatggaagccgtcgctaatggcctaagtttagcaccagttcaagcc
ttgcggggaggagcttttaaaccaagaacctccccgcattctttccaaggactcggccta
gaagggttgaaaattcttgcagaggttaaacggcgttacggtattcccgtggtaacagaa
gtgatgtctactgagcaaatagaagcagtagcaacctacgctgatatgttacaggttggt
agccgaaatatgcaaaattttgagttactcaaagcattaggccacgtcaataaacccatc
ctcctcaaacggggtttagcggctacccttgaagagtttattggtgcagcagaatacatt
ttgagccatggtaacacacaggtagtcctctgtgagcgaggaatccgcagttttgataac
tacactcgcaatgtgctagatttaggggcagttgtcgctctaaaacagcttacctgttta
cccgtgattgttgatccctcccacgcagccggtagacgggaattaattgcgcctttagct
aaggcagcgatcgcggccggggctgatggattaattatagaatgccatcctcagcccgaa
aaatcggtttctgacgcagcacaagccctttctttagaagaaatggtcagtttagtccat
agcttacaacctatcgctcaagctattggccgttctattgtaccgttttctcgttcacta
attgcagcttga

DBGET integrated database retrieval system