KEGG   Cyanothece sp. PCC 8802: Cyan8802_3697Help
Entry
Cyan8802_3697     CDS       T00968                                 

Definition
(GenBank) hypothetical protein
  KO
K07027  glycosyltransferase 2 family protein
Organism
cyh  Cyanothece sp. PCC 8802
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyh02000]
    Cyan8802_3697
Transporters [BR:cyh02000]
 Other Transporters
  Others
   Cyan8802_3697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LPG_synthase_TM
Motif
Other DBs
NCBI-ProteinID: ACV02509
Position
3774726..3775649
Genome map
AA seq 307 aa AA seqDB search
MKPIISLIKPYLRWFIFATTLVFIVKIFKDNWQNITEVHLTINGWLWLILSLFMTLIAHI
WSAWVWTWIFQTFQQSFSHLWGIRVYLITNIAKYLPGNVGHFYGRVSAISQQGSSLSVAS
FIVLLEPLLMAASALLIALFSHLIGLIETTSNPWLLTLQILSLVIVLLGLHPFILNQIIL
TSNKFNKTDKKASVSLEKYPSFLLLGEIGFILLRGLGFLGTWVAFMPITIYQIPQLLSAF
SFAWLLGLIIPGAPGGIGVFEATMITLLKTSNFPLSILLSTIAIFRVISIIAELLGAGLG
LLLKNRE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgattatctcattaatcaaaccttatttgagatggtttatcttcgcaactacc
ttggtttttatcgtaaaaatttttaaggacaactggcaaaatatcacagaagttcatcta
actattaacggatggttatggttaatcctaagtttattcatgaccttaattgctcatatt
tggtcagcgtgggtttggacttggatattccaaacctttcaacaaagttttagtcatctt
tggggaataagggtgtatttaatcacgaatattgccaaatatttaccaggaaatgttggt
catttttatggcagagtttccgcgatttctcaacagggaagttctttaagtgttgctagt
tttatcgtattactagaacctttattaatggcagcatcagccttgttaattgctttattt
agtcatttaattggcttaattgagaccacctctaacccctggttattaactttacaaatt
ttaagtttagtaatcgttttattaggacttcatccgttcattttaaatcaaattatttta
acttctaataaattcaacaaaaccgacaaaaaagcatcagtttctttagagaaatatccc
agttttcttttattaggagaaataggatttattctattaagaggacttggttttcttggc
acttgggtggcctttatgccaatcacaatttatcaaattcctcaattactcagtgctttt
agttttgcttggctactcggattaattatcccaggagcccctggaggaataggagtcttt
gaagctaccatgattaccttactcaaaacctcaaattttcccctcagtattcttctgagt
actattgccatttttcgggtgataagtattatcgctgaactcctaggtgctggactagga
ttattattgaaaaatagagaatag

DBGET integrated database retrieval system