KEGG   Cyanothece sp. PCC 8802: Cyan8802_3710Help
Entry
Cyan8802_3710     CDS       T00968                                 

Definition
(GenBank) ATP synthase F1, epsilon subunit
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh00190  Oxidative phosphorylation
cyh00195  Photosynthesis
cyh01100  Metabolic pathways
Module
cyh_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Cyan8802_3710
   00195 Photosynthesis
    Cyan8802_3710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:cyh00194]
    Cyan8802_3710
Photosynthesis proteins [BR:cyh00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Cyan8802_3710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE
Motif
Other DBs
NCBI-ProteinID: ACV02522
Position
complement(3790372..3790782)
Genome map
AA seq 136 aa AA seqDB search
MALQVRVITPDKIVWDGDVEEAILPSTSGQLGILPSHAPLLTNLDIGVMRVRLDKDWKSL
VVMGGIAEVEQDILQVLVNSAEIGDDITKEDAQADFSEAQSRLEEANKGSDRREQIKASQ
AYKRARARLQAAGGLV
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcgttacaagttcgtgtaattaccccagataaaattgtttgggatggcgatgtggaa
gaagccatcctacccagtacctcaggacaattgggtattcttccgagtcacgccccctta
ttgactaacctagatattggggtcatgcgagtgcgcctcgataaagactggaaaagctta
gttgtgatgggtggcatcgctgaagttgagcaagatatcttgcaagttttggtgaattca
gcagaaattggcgatgatattactaaagaagacgcacaagctgactttagcgaagcccaa
tcccgtctagaagaagccaacaaaggcagcgatcgccgcgagcaaattaaggcatcacaa
gcttacaaacgggctagagcacgtctgcaagcggccggtggattggtttaa

DBGET integrated database retrieval system