KEGG   Cyanothece sp. PCC 8802: Cyan8802_3723Help
Entry
Cyan8802_3723     CDS       T00968                                 

Definition
(GenBank) excinuclease ABC, B subunit
  KO
K03702  excinuclease ABC subunit B
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    Cyan8802_3723
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cyh03400]
    Cyan8802_3723
DNA repair and recombination proteins [BR:cyh03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cyan8802_3723
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      Cyan8802_3723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_C UvrB UVR ResIII AAA_30 DEAD HEM4 DUF853 AAA_16 Terminase_1
Motif
Other DBs
NCBI-ProteinID: ACV02535
Position
complement(3806320..3808323)
Genome map
AA seq 667 aa AA seqDB search
MTFSSFRLQAPFEPQGDQPQAIAQLLASLQAGNRFQTLLGATGTGKTFSIASVIEKVGKP
TLVLAHNKTLAAQLCNELRQFFPDNAVEYFISYYDYYQPEAYIPVSDTYIEKSSSINDEI
DMLRHSATRSLFERKDVIVVASISCIYGLGMPSEYLKAAVPLEVGQEVDQRNLLRELVGI
QYSRNDIELQRGRFRVKGDVLEIVPAYEDRIIRVEFFGDEIEAIRYLDPVTGEILQSLKM
VNIYPARHFVTPDEQIEIACQQIKVELEEQIEALEKEGKLLEAQRISQRTRYDLDLLQEV
GYCNGVENYSRYLAGRKAGEPPECLIDYFPQDWLLVVDESHVTVPQLRGMYNGDRSRKQV
LIDHGFRLPSAADNRPLKSEEFWTKVNQCIFVSATPGDWEIEQSGDRIIEQIIRPTGVLD
PEIFVRPTEGQVDDLLGEIKQRVKRQERVLITTLTKRMSEDLTEYLSERGVKVQYLHSEV
KSIERIEILQSLRKGEFDVLIGVNLLREGLDLPEVSLVAILDADKEGFLRAERSLIQTIG
RAARHVNGQAILYADNLTKSMIKAIEETERRRGIQMAHNKINNITPKPIIKKETNSILSF
LDISRRLNSQQLEEIYEKSDDLPLEKVPELIQQLENQMKEAAQKLEFEEAAKYRDRIKNL
RDKLLGN
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgacatttagctcttttcgtttgcaagccccctttgaaccccaaggtgatcaaccccaa
gcgatcgcccaattattggcttctctccaagctggaaaccgctttcaaacgttattaggg
gcaacaggaacggggaaaaccttctctattgcttctgtgatcgaaaaggtgggtaagcca
accctcgtcttagcccataataaaacattggcggcgcaattgtgtaacgaattacgacaa
tttttccccgataatgcggtggaatattttattagttattacgattattatcaaccggaa
gcctatattcctgttagtgatacttatattgagaaaagttcgtccatcaacgacgaaatt
gatatgttacgtcactcggcaacccgttcgttatttgaacgaaaagatgtgattgttgtt
gcctctattagttgtatttatggcttaggaatgccctcagaatatctcaaagcagccgtt
cctttagaagtgggtcaagaagttgatcaacggaacttattacgcgagttagtcgggata
caatattctcgcaatgatattgaattacaacggggtagatttcgggttaaaggtgatgtt
ttggaaatcgttccagcttatgaagatcgtattattcgggtcgaattttttggcgatgaa
attgaggctattcgctacctcgatcccgttacgggagaaattctccaaagtcttaaaatg
gttaatatttatcccgcccgtcactttgttacccccgatgaacaaatcgagattgcttgt
caacaaattaaggttgaattagaagaacaaattgaagccctagaaaaagagggaaaatta
ttagaagcgcaacggattagtcaacgaacccgctacgatttggacttattacaagaggtg
ggttattgtaatggagtagagaattattcccgttatttagccggaagaaaagcgggggaa
cctcctgaatgtttgattgattatttccctcaagattggctattagtcgtggatgaatcc
catgttaccgtgccccaattacggggaatgtataacggcgatcgctcccgtaaacaagtg
ttaattgaccatgggtttcgtttacccagtgctgccgataaccgtcctttaaaatcggaa
gaattttggactaaagtcaatcaatgtatctttgtttcggcaacccctggtgactgggaa
attgaacaatctggcgatagaattattgagcaaattattcgacccacaggagtattagat
cctgagatttttgtccgtccaaccgagggacaagtggatgatttattaggggaaattaaa
caaagagttaaacgacaagaacgggttttaattactactttgaccaagcggatgtctgag
gatttaacggaatatttgagtgagcgaggagtgaaggttcaatatctccattctgaagta
aaatccattgaacgaattgagattttacagtccttaagaaaaggcgaatttgatgtctta
attggggtcaatttattgcgagaaggattggatttacccgaagtttctttagtggctatt
ttagatgccgataaggagggatttttaagggcagaacgttctttaattcaaactattgga
cgcgcagcacgtcatgttaacggacaggctattttatatgctgacaatttaaccaaaagt
atgattaaagcaatagaagaaaccgagagaaggcggggtattcaaatggctcataataag
ataaataatattacgccaaaaccaattattaaaaaagaaactaattcgattttatctttt
ctcgatatttcacgccgtctcaactctcaacaactcgaagaaatttatgaaaaatccgat
gatttacccttagaaaaagttcccgaattaattcaacaattagagaaccaaatgaaagag
gctgctcaaaaattagaatttgaagaagcggcaaaatatcgagatagaattaaaaattta
cgcgataaattattaggaaattag

DBGET integrated database retrieval system