KEGG   Cyanobium sp. NIES-981: CBM981_0609Help
Entry
CBM981_0609       CDS       T04888                                 

Gene name
gnd
Definition
(GenBank) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
cyi  Cyanobium sp. NIES-981
Pathway
cyi00030  Pentose phosphate pathway
cyi00480  Glutathione metabolism
cyi01100  Metabolic pathways
cyi01110  Biosynthesis of secondary metabolites
cyi01120  Microbial metabolism in diverse environments
cyi01130  Biosynthesis of antibiotics
cyi01200  Carbon metabolism
Module
cyi_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cyi_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cyi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CBM981_0609 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CBM981_0609 (gnd)
Enzymes [BR:cyi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     CBM981_0609 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     CBM981_0609 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 PGK F420_oxidored Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: SBO42320
UniProt: A0A182AMP1
Position
I:complement(520747..522165)
Genome map
AA seq 472 aa AA seqDB search
MGSAHFGLIGLGVMGENLVLNAERNGFSSVVYNRTYAKTEAFLQGRGAGKDIVGARTLEE
FVAALERPRRILMMVKAGQPVDDTIASISPLLEEGDLLIDGGNSLYTDTERRVAQLESQS
FGYIGMGVSGGAKGALEGPSMMPGGTRSAYDAIEPLVRKMAAQVDDGPCVTYIGPGGAGH
FVKTVHNGIEYGIEQILAEAYDLMKRCGGMNGDQMADVLALWNDSEELASFLVEITEVCL
RTKDPSSGTDLVEQIVDAAGQKGTGLWTVVSALEMGVPVPTIYAALNARVLSSLRPERLA
AEAVLHGPGPHGVELGAPAEGLAPLRDACIAACIVSYGQGMALLQEASKLHDYGLDFAAI
GQIWKGGCIIRARLLQRIQDAYTASPDLPNLMLDPWFAEQINRRLPGLRRIVAGAALAGI
PVPCLSSTLDYIDSYRTGRLPQNLVQAMRDCFGSHTYERVDKPGSFHTEWLD
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgggatcggcacatttcggcctgatcggcctcggcgtgatgggggagaacctggtgctc
aatgcggagcgcaacgggttttccagcgttgtctacaaccgcacctatgcgaagacggaa
gccttcctgcaggggcgcggcgccggcaaggacatcgtgggcgcgcgcaccctggaggag
ttcgtggccgcccttgagcgtccccggcgcatcctgatgatggtgaaggcggggcagccg
gtggatgacaccatcgcctcgatctcccccctgctcgaagaaggcgatctcctcatcgac
ggcggcaactcgctgtacacggataccgaacggcgtgtggcccagctggagagccagagt
ttcggctacatcgggatgggtgtctccggcggcgcgaagggtgccctcgaaggtccgagc
atgatgcccggcggcacccgttcggcctacgacgcgatcgaaccgctggtgcgcaagatg
gccgcccaggtcgacgacggcccctgcgtcacctacatcggccccggtggtgccggccac
ttcgtgaagaccgtgcacaacggcatcgaatacggcatcgagcagatcctggccgaggcc
tacgacctgatgaagcgctgcggcggcatgaacggcgatcagatggccgatgtgctggcc
ctctggaacgacagcgaggaacttgcctccttcctggtggagatcaccgaagtgtgcctt
cgcaccaaggaccccagcagcggtaccgacctggtggagcagatcgtggatgcggcaggc
cagaagggcaccggtctgtggaccgtagtgagtgcgctggagatgggggttcccgttccc
acgatctacgccgccctcaatgcccgcgtgctcagctccctgcgtcccgagcgcctggcg
gccgaggccgtgctccacggtccgggcccccatggggtggagctgggcgctccggccgaa
ggcctggcgcctttgcgggatgcctgcatcgccgcctgcatcgtgagctacggccagggc
atggccctgctccaggaagcttcgaaactgcacgactacggcctggacttcgccgccatc
ggccagatctggaaggggggctgcatcatccgggcccgcctgctgcagcgcatccaggat
gcctacaccgcctcccccgatctgccgaacctgatgctcgacccctggttcgccgagcag
atcaaccggcgcctgcccggcctgcgccggatcgtggccggcgccgcgcttgccggcatc
ccggtgccctgcctgtccagcaccctcgactacatcgacagctaccgcacgggccggttg
ccccagaacctggtgcaggccatgcgcgactgcttcggctcccacacctacgaacgggtc
gacaaaccgggcagcttccataccgaatggctggactga

DBGET integrated database retrieval system