KEGG   Cyanobium sp. NIES-981: CBM981_0778Help
Entry
CBM981_0778       CDS       T04888                                 

Definition
(GenBank) putative pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
cyi  Cyanobium sp. NIES-981
Pathway
cyi00790  Folate biosynthesis
cyi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CBM981_0778
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cyi04147]
    CBM981_0778
Enzymes [BR:cyi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     CBM981_0778
Exosome [BR:cyi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBM981_0778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: SBO42489
UniProt: A0A182AM19
Position
I:complement(686632..686919)
Genome map
AA seq 95 aa AA seqDB search
MAAVPLTGEQIADLPSALPDWQLVEGKLRRELRFTDFVAAFGFMTQVALVAEAMGHHPEW
SNVWNRVVVTLTTHDTGGLSDLDLELARRIDALAS
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgttcccctcacaggcgagcagatcgccgacctccccagtgccctgccggac
tggcagctggtggagggcaagctgcgccgcgagctgcgcttcacggacttcgtggccgcc
ttcgggttcatgacccaggtggctttggtggcggaagccatgggccaccatcccgagtgg
agcaatgtgtggaaccgggtggtggtgaccctcaccacccacgacaccggtgggctgtcc
gacctggatctggagctggcgcggcggatcgatgccctcgcttcctag

DBGET integrated database retrieval system