KEGG   Cyanobium sp. NIES-981: CBM981_1045Help
Entry
CBM981_1045       CDS       T04888                                 

Gene name
chlL
Definition
(GenBank) Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
cyi  Cyanobium sp. NIES-981
Pathway
cyi00860  Porphyrin and chlorophyll metabolism
cyi01100  Metabolic pathways
cyi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CBM981_1045 (chlL)
Enzymes [BR:cyi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     CBM981_1045 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA AAA_24 MeaB MipZ NB-ARC SRP54 AAA_26 AAA_16 AAA_25 CBP_BcsQ RNA_helicase
Motif
Other DBs
NCBI-ProteinID: SBO42756
UniProt: A0A182ALN5
Position
I:934418..935302
Genome map
AA seq 294 aa AA seqDB search
MTTTLRRPDGEGSLQVHQDPSVGIETGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKRVL
QIGCDPKHDSTFTLTKRMVPTVIDILEEVDFHSEELRPEDFVFEGFNGVQCVESGGPPAG
TGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHAHYCLIVTANDFDS
IFAMNRIIAAIQAKAKNYKVRLGGVVANRSKDTDQIDRFNDRVGMRTMAHFPDLDAIRRS
RLKKCTIFEMEPTPEVEAVQQEYLRLAQAMLENVRPLEAESLKDREIFDLLGFD
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaccctgcgccgccccgacggagaaggcagcctccaggtccaccaggatccc
agcgtcggcatcgagaccggcgccctcgtgatcgccgtctacggcaaggggggcatcggc
aaatccaccacctcctcgaacctctcggcggccttctccaagctgggcaagcgggtgctg
cagatcggctgcgaccccaagcacgattccaccttcacgctcaccaagcggatggtgccc
acggtgatcgacatcctcgaggaggtggacttccacagcgaggaactgcggccggaggac
ttcgtgttcgagggcttcaacggcgtgcagtgcgtggagtcgggcgggccgccggcgggc
accggctgcggcggctacgtgaccggccagacggtgaagctgctcaaggagcaccacctg
ctggaggacaccgacgtggtgatcttcgatgtgctgggtgatgtggtgtgcggcggcttc
gcggcgccgctgcagcacgcccactactgcctgatcgtgacggcgaacgacttcgactcg
atcttcgccatgaaccggatcatcgccgccatccaggccaaggcgaagaactacaaggtg
cggctcggcggtgtggtggccaaccgcagcaaggacaccgaccagatcgaccgcttcaac
gaccgggtggggatgcgcaccatggcccacttccccgacctcgacgccatccgccgctcg
cggctgaagaagtgcaccatcttcgagatggagcccacgcccgaggtggaggcggtgcag
caggaatatctgcggctggcccaggccatgctcgagaacgtgcggcccctggaggccgaa
tcgctcaaggatcgcgagatcttcgatctgctcggcttcgactga

DBGET integrated database retrieval system