KEGG   Cyanobium sp. NIES-981: CBM981_1216Help
Entry
CBM981_1216       CDS       T04888                                 

Gene name
cobB
Definition
(GenBank) Cobyrinic acid A,C-diamide synthase
  KO
K02224  cobyrinic acid a,c-diamide synthase [EC:6.3.5.9 6.3.5.11]
Organism
cyi  Cyanobium sp. NIES-981
Pathway
cyi00860  Porphyrin and chlorophyll metabolism
cyi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CBM981_1216 (cobB)
Enzymes [BR:cyi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.9  hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing)
     CBM981_1216 (cobB)
    6.3.5.11  cobyrinate a,c-diamide synthase
     CBM981_1216 (cobB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 Fer4_NifH
Motif
Other DBs
NCBI-ProteinID: SBO42927
UniProt: A0A182AM39
Position
I:1113283..1114788
Genome map
AA seq 501 aa AA seqDB search
MPCLIAAPCSGSGKTLLTLSLAALARQRGLRLQPFKVGPDYLDPQLLSQVSGLPCRNLDP
ILCGEAWVRRCFHWHGSRADLALVEGVMGLFDGRGPGSEGSSAAVAALLDLPVVLVVEAS
RQAGSLAALVRGFRDHGPPPVRLAGVVLNRVNSARHRQLLAEALEAIAVPLLGVLPSDPA
LDWPERHLGLLPPQEQADLPERQQAWAALAERHLDLEQLWPLLAPAAPASGPGHGDPIDW
LLGSHSPSRSGHHRMGSGTGMASGSGMLSGPLPVAVAQDAAFHFRYPEADELLRGCGLDP
RPWSPLADEPLPPGTRAVLLPGGYPELHAAPLAAAGRSLAALRQAARTGLPIAAECGGLL
LLGETLGDPEGRTHPMAGVLPFSARRGALSLGYREALAGSDGLLVRRGESFRGHEFHRWQ
LQTVTDGGGLWQLEGWGSPRRSEGWTTPTLHASWLHLHWAGCPRIPSRLAAAAASAAVAP
ARSLPSHRVLPDGGDRQSAGA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
ttgccctgcctgatcgcggccccctgcagcggcagcggcaagaccctgctcaccctgagc
ctggcggccctggcccgccagcggggcctgcggctgcagcctttcaaggtggggcccgac
tacctcgacccgcagctgctcagccaggtgagcgggctgccctgccgcaacctcgacccc
atcctgtgcggcgaggcctgggtgcggcgctgcttccactggcacggcagccgggccgat
ctggcgctggtggagggggtgatgggcctgttcgacgggcggggccccggcagcgagggc
agctcggcggcggtggccgccctgctggatctgccggtggtgctggtggtggaggcctcc
cgccaggccggctcactggcggccctggtgcggggcttccgcgaccacggcccgccgccg
gtgcggctggccggggtggtgctgaaccgggtgaacagcgcgcggcaccggcagctgctg
gcggaagccctcgaggccatcgccgtgcccctgctgggcgtgctgcccagcgatccggcc
ctggactggcccgagcgccacctggggctgctgccgccccaggagcaggccgacctgccc
gagcgccagcaggcctgggcggctctggcggagcgccacctggatctggagcagctctgg
cccctgctggccccggcggcgccggccagcggccccgggcacggggatccgatcgactgg
ctgctgggctcccactccccatcccggtccggccaccacaggatgggttcgggaaccggg
atggcgtccgggagcggaatgctttcggggcccctgccggtggccgtggcccaggacgcg
gcgtttcacttccgctacccggaagccgatgagctgctgcggggctgcgggctcgatccc
cggccctggagcccactggcggacgagcccctgccaccgggcaccagggccgtgctgctg
ccggggggctatccggaactccatgccgccccactggcggcggcgggccgcagcctcgca
gccctgcggcaggcggccaggactggcctgccgatcgcggccgaatgcggcgggctgctg
ctgctgggcgaaaccctcggcgatcccgagggccggacccaccccatggccggcgtgctg
ccgttctcggcccggcgcggagcgctcagcctcggctaccgcgaggccctggccggcagc
gatggcctgctggtgcggcgcggggagagcttccgcggccatgagttccaccgctggcag
ctgcagacggtgacggacgggggagggctgtggcagcttgaaggctgggggagccctcgc
cggagcgaaggatggacaacaccgaccctgcacgccagctggctgcatctccactgggct
ggatgcccgcggattccttcccggctggccgccgcagccgcgagcgccgcagtggcaccc
gcccgcagccttccttcccatcgggtgcttccggatggcggggaccggcagagcgctggc
gcctga

DBGET integrated database retrieval system