KEGG   Cyanothece sp. PCC 7822: Cyan7822_0493Help
Entry
Cyan7822_0493     CDS       T01310                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00860  Porphyrin and chlorophyll metabolism
cyj01100  Metabolic pathways
cyj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cyan7822_0493
Enzymes [BR:cyj01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cyan7822_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 Mg_chelatase AAA_16 DUF815 AAA_29 Sigma54_activat AAA_23 AAA AAA_14 AAA_30 AAA_18 AAA_3
Motif
Other DBs
NCBI-ProteinID: ADN12536
UniProt: E0U8A0
Position
542075..543028
Genome map
AA seq 317 aa AA seqDB search
MNTISPIPILPYSRIVGQEQLKLALEIAYIAPRLGGVLISGHRGTGKSTAVRAFSQMLYG
DLPVTLPINATEDRVVGGWKIDELMQSKAVWQAGLLEEAAKKLLYVDEINLLDDHIVNII
LDVTSTGVLVVQREGQSEQKALSFTLVGTMNPEEGGLRPQLLDRFGLMVSVTAEMEEQRR
LAILQNVLAFEEALVQLDLENKSEFLELAKKENQEKVQQLKAAKEKVYSIKVASKALNQC
ITLGKRFQVEGNRGDFILAMAARACAALQGAETVNSEHIRAVVPLALQHRRPEMAQSNQG
VWHDQDNETVAEILESE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaatatcgccgatcccaattctcccttacagccgaattgtcggacaagaacaa
cttaaacttgccctagaaattgcttatattgcaccccggctaggaggagtattgattagt
ggacatcggggaacgggcaaatcaacggctgtgcgagcattttcgcagatgctttacggg
gacttacccgtaactttaccgatcaatgccacagaagatcgggtagtgggaggctggaaa
attgatgaattgatgcagagtaaggcagtttggcaagcgggtttattagaagaagccgcc
aaaaaactgctttatgttgatgagattaacttattagacgatcatattgtcaatatcatc
ctcgatgtcacctcaacaggagtgctagtggtgcagcgagaagggcagagtgagcaaaaa
gccttgtcttttaccttagtaggaacgatgaacccagaagaaggaggtttgcgtccccag
ttgcttgatcgttttggtttaatggttagtgttaccgccgagatggaagaacagcgcaga
ttagcgattctgcaaaatgttctcgcctttgaagaagcacttgttcagcttgatttggag
aacaaatcagaatttttagaattagccaagaaagaaaatcaggaaaaagttcaacagcta
aaagcagcaaaggaaaaagtttatagcatcaaagttgcctcaaaagcacttaatcaatgt
attacgctaggaaaaaggtttcaagtagaaggcaaccgaggagattttatcttagcaatg
gcggcgcgggcttgtgctgcgttacaaggggcagaaaccgtcaatagtgaacatattcgg
gcagtagtccctttagcccttcaacaccgtcggccagaaatggcacagagtaatcagggg
gtgtggcatgaccaagataatgagactgtagcggagattttagagagtgagtaa

DBGET integrated database retrieval system