KEGG   Cyanothece sp. PCC 7822: Cyan7822_0606Help
Entry
Cyan7822_0606     CDS       T01310                                 

Definition
(GenBank) CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00564  Glycerophospholipid metabolism
cyj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Cyan7822_0606
Enzymes [BR:cyj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     Cyan7822_0606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf RexB
Motif
Other DBs
NCBI-ProteinID: ADN12642
UniProt: E0U9F0
Position
672427..672987
Genome map
AA seq 186 aa AA seqDB search
MNLPNWITFSRLLGIPFIVYLLHDPTPNHRLIGVIIFLIAAATDWLDGYLARKLNQITEL
GKFLDPLVDKLLVLAPLLSLIELGQIPAWGVFLILLRELSIAGWRVNPQLTGNSSISGAN
FWGKLKTVTQISAIALLIGPLPPAWTTPGLILFWVSVILTLISGLIYVLPQRVDKISSST
EKSISA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaacctacccaattggattaccttttcacgtcttttaggaataccctttatcgtctat
ttattgcacgatcctacccctaaccatcgtcttatcggtgtcattatcttcttaattgcc
gccgccactgactggttagatggatatttagcccgtaaactcaaccaaataaccgaatta
ggcaaatttttagatcccttagtggataaattactggtattagcacctctgttatccctg
atcgaattagggcagatacccgcttggggagtctttttaattttactcagagagttgtct
attgctggttggcgggttaatcctcaactaaccggtaatagtagtattagtggggctaat
ttctggggaaaactcaaaaccgtgactcaaattagtgccattgccctattgataggtccg
cttcctccagcatggacaactcctggtttaatcctgttttgggtgtcggttattctgacg
ttaatttctgggcttatttacgttttacctcagagagttgacaaaatttcctcatccacc
gagaaatcaatctccgcttga

DBGET integrated database retrieval system