KEGG   Cyanothece sp. PCC 7822: Cyan7822_1688Help
Entry
Cyan7822_1688     CDS       T01310                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00010  Glycolysis / Gluconeogenesis
cyj00051  Fructose and mannose metabolism
cyj00562  Inositol phosphate metabolism
cyj00710  Carbon fixation in photosynthetic organisms
cyj01100  Metabolic pathways
cyj01110  Biosynthesis of secondary metabolites
cyj01120  Microbial metabolism in diverse environments
cyj01130  Biosynthesis of antibiotics
cyj01200  Carbon metabolism
cyj01230  Biosynthesis of amino acids
Module
cyj_M00002  Glycolysis, core module involving three-carbon compounds
cyj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7822_1688
   00051 Fructose and mannose metabolism
    Cyan7822_1688
   00562 Inositol phosphate metabolism
    Cyan7822_1688
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7822_1688
Enzymes [BR:cyj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cyan7822_1688
Exosome [BR:cyj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cyan7822_1688
  Exosomal proteins of bladder cancer cells
   Cyan7822_1688
  Exosomal proteins of melanoma cells
   Cyan7822_1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADN13677
UniProt: E0U7I1
Position
1842757..1843449
Genome map
AA seq 230 aa AA seqDB search
MYKTQAEALEFVQTFKSKVDNTNESREIVLCAPFTTLGAMSKNLHGSRIRLGAQNIHWED
AGAYTGEIAGPMLTEIGVNYVIIGHSERRQYFGETDETVNLRLLAAQKHGLIPILCVGES
KSQRDAGETEKIIINQLKRDLVDVDQNNLVIAYEPIWAIGTGDTCESTEANRVIGLIREQ
LTNKNVPIQYGGSVKPNNIDEIMKQSEIDGALVGGASLDPADFASIVNYQ
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagactcaagcagaagctttagagtttgtgcaaacatttaaatccaaagtagac
aatacaaacgaatctagagaaattgtcctctgtgccccgtttacaactttaggagccatg
tctaaaaatttacatgggagccgcattaggttaggggcacaaaatatccactgggaagat
gccggtgcttatacaggtgaaattgcaggacctatgcttaccgaaatcggggttaattac
gtgattattggtcacagcgaacgccgccagtatttcggagaaaccgatgaaactgtcaat
ttacgactccttgccgctcaaaaacatggcttgattcctattctgtgcgtcggggaatct
aaatcacaacgagatgccggtgaaaccgaaaagattatcattaatcaattaaaacgagat
ttggtagatgtagatcaaaataatctcgtgattgcttatgaacctatctgggccattgga
accggtgacacttgtgaatccactgaagctaaccgagtgattggtttaattcgagagcag
ttgaccaataaaaatgttccgattcagtatggcggctccgttaaacccaataatattgat
gaaattatgaaacaatcggaaatagatggggctttagtcgggggagctagtttagatccg
gcagattttgctagtattgttaattatcaatag

DBGET integrated database retrieval system