KEGG   Cyanothece sp. PCC 7822: Cyan7822_4633Help
Entry
Cyan7822_4633     CDS       T01310                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00900  Terpenoid backbone biosynthesis
cyj01100  Metabolic pathways
cyj01110  Biosynthesis of secondary metabolites
cyj01130  Biosynthesis of antibiotics
Module
cyj_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cyan7822_4633
Enzymes [BR:cyj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Cyan7822_4633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ADN16539
UniProt: E0UDV4
Position
complement(5065213..5066409)
Genome map
AA seq 398 aa AA seqDB search
MKKISVLGSTGSIGTQTLDIVAQYPDQFQVVGLAAGNNVELLSAQVHQFRPQIVAICNTA
HVSALKEALSSLDYSPIIVAGEAGVVEVAAYGDAESVVTGIVGCAGLLPTIAAIKAGKDI
ALANKETLIAGGPVVLPLIEKHGVKLLPADSEHSAIFQCLQGVPEKGLRKIILTASGGAF
RDLPVEKLSSVTVQDALKHPNWSMGRKITIDSATLMNKGLEVIEAHYLFGVDYDAIDIVI
HPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTDWETLDLVKVGSLTFREP
DHDKYPCMQLAYAVGRAGGAMPAVLNAANEQAVALFLAEKIGFLDIPRLIEMVCDRFTTQ
NTSTPTLDDIIAADGWARAEVLRAYEMTQIKGPVVSVL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaatctctgttctcggttctacaggttctattggtactcaaacccttgatatt
gtcgctcaataccccgatcaatttcaagtggtcgggttagcagccggtaacaatgtggag
ttactctcggcccaagtgcatcaattccgcccccaaattgtcgctatttgcaatacggct
catgtttctgccctaaaagaggctctttcatccctagattattctcctattatcgttgct
ggagaagcgggtgtcgtcgaagttgccgcttatggagatgcagaaagtgttgttaccggt
attgtgggatgtgcaggacttttacccactatcgccgccattaaagccggtaaagatatc
gctttagctaataaagaaaccttaattgctgggggtccggtggttctgcctttaattgaa
aaacacggggttaaattattacccgccgactcagaacattcggctatttttcaatgtctt
caaggtgtacccgaaaaagggttgagaaagattattttaaccgcttcgggtggggctttt
cgcgatttaccggtagaaaaattaagctcggttacggtacaagatgcccttaaacatcct
aactggtctatgggtcgaaaaattaccattgattcagccactttgatgaataaaggctta
gaagtcattgaagctcattatttatttggtgtagactatgatgccatcgacattgtgatt
catccccaaagtattattcattctcttattgagttacaagatacctcggttttggctcag
ttgggctggcctgatatgcgtttaccgttactctatgccctgtcttggccagaacggatt
tatactgattgggaaactttagatttagttaaagttggtagtttgactttccgagaaccg
gaccatgataaatatccctgtatgcagttagcttacgctgttgggcgggccgggggagcg
atgccggctgtgttgaatgcggctaatgagcaagcggtagcactatttttagcagaaaaa
atcggctttttggatattccccgtttaattgaaatggtctgtgatcgctttacgactcaa
aatacttctacgcctaccttagatgatattattgcggctgatgggtgggcaagagccgaa
gtgcttcgcgcctatgaaatgacccaaataaaaggtcctgttgtttcagttctataa

DBGET integrated database retrieval system