KEGG   Cyanothece sp. PCC 7822: Cyan7822_5572Help
Entry
Cyan7822_5572     CDS       T01310                                 

Definition
(GenBank) MCP methyltransferase, CheR-type with PAS/PAC sensor
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj02020  Two-component system
cyj02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cyan7822_5572
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Cyan7822_5572
Enzymes [BR:cyj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Cyan7822_5572
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Cyan7822_5572
Two-component system [BR:cyj02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Cyan7822_5572
Bacterial motility proteins [BR:cyj02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Cyan7822_5572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheR_N PAS PAS_9 PAS_4 PAS_8 PAS_10 IncA Spc7 WEMBL DUF3584 HMMR_N TelA Methyltransf_12 Rootletin IFT57 Golgin_A5 Tropomyosin Fez1 Exonuc_VII_L APG17 APG6 DUF4407 Atg14 HemX Fusion_gly OmpH EzrA DUF4201 DUF4795 DUF812 TPR_MLP1_2 FapA DUF5089 Mnd1 LXG DUF1664 Sec8_exocyst HAUS-augmin3 Uds1 ERM GAS Jnk-SapK_ap_N TACC TMPIT CALCOCO1 UPF0449 DUF3540 Bap31 TMF_TATA_bd MAP70 Laminin_II AAA_13 DASH_Duo1 SesA LMBR1 Pox_Ag35 Tropomyosin_1 ATG16 V_ATPase_I PAS_3 Neur_chan_memb Lebercilin DUF3450 HrpB7 zf-C4H2 TBPIP FUSC Prefoldin_3 DUF16 AAA_23 DUF4618 DUF4200
Motif
Other DBs
NCBI-ProteinID: ADN17444
UniProt: E0UAD9
Position
complement(6050130..6052004)
Genome map
AA seq 624 aa AA seqDB search
MSKKEDEQEQIFETLLEFLKQSRGFDFTGYKYSSLKRRVRKQMQSHNIDNFSDYLDYLQV
HPEEFLPLFNTILINVTAFYRDPKAWQYLQHQVLPQVFNSESDSKTIRVWCAGCSSGEEA
YTLAMMLAQILGIEKFRQRVKIYATDVDEEALVQARHASYSNKELEPIPQEIRELFFETV
GNRFIFRPDLRRCVIFGRHDLVQDAPISRLDLLVCRNTLMYFNAETQAKILHRFHFALKN
SGILFLGKAEMLLTHSHLFTPINLQHRIFRPTPKSQRPERGIYIPNENDEANNTIERYIR
LRELAFDTVPIAQLIVELNGHLVLANEPARTLFGLNILDQGRPLQDLEISYRPLELRSYI
DEVYRNRASVVVNDVVRNLRDNTTQYLDVNIDLLEESNGELLGVSITFTDVTRYHDLQVE
LQRANQELETANEELQSSNEELETTNEELQSTNEELETTNEELQSTNEELETMNEELQST
NEELQTINDELRQRTTDLNQANAFLNSILASLQAAVVVVNRQFNILTWNEEAENLWGLRS
EEVQGESILSLDIGLPVEQLREPIRNCLSATINSQEILLEAINRRGRKINCRVSFNPLIG
HEKELQGVILLMEELTSALVETDS
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaagaggacgagcaagaacaaatatttgaaactcttttagaatttctcaaa
caatcgcggggatttgatttcacgggatataaatactccagtctaaagcggcgagtccgt
aaacaaatgcaaagccataacattgacaactttagcgattatttagactatttacaagtt
catcccgaagaatttctccccctattcaacacgattttgatcaatgtgaccgctttttac
cgcgatcctaaagcttggcagtatctccagcatcaagttcttccccaagtttttaactca
gaatcagactccaaaacgattcgggtgtggtgtgccggttgttcttcgggagaagaagcc
tacactttagccatgatgctggcccaaatcctgggaatagaaaaatttcgccagcgagtc
aaaatttatgccaccgacgtagacgaagaagccttagtgcaagctcgtcatgccagttac
agcaacaaagaactcgaacccattccccaagagatacgggagctattttttgaaacagta
ggaaatcgctttatttttcgtcctgatttgcgtcgctgcgtaatttttggtcgtcatgac
ttagtacaggatgcgcctatttctcgcctggacttattggtgtgtcgtaacaccttaatg
tattttaatgccgaaacccaagccaaaattctgcatcgttttcattttgccttgaaaaat
tcaggtattctgtttttagggaaagcagaaatgctgctcactcatagtcatctgtttacc
cccatcaatctgcaacatcgcatttttcgtccaacccctaaaagccagcgaccagagcga
ggtatttatatccctaacgagaatgacgaagcaaacaacaccattgaacgctacatccgc
ctccgagaattagcgtttgatacagttcccatcgcgcaactgatagtggagttgaatggt
catttagtgctggccaatgagccggcccgaaccctgtttggcctcaacatcttagatcag
ggtcgtcctttacaagatttagaaatttcttatcgtcctctagagttacgttcttatatt
gatgaagtttatcgcaatcgtgccagtgtggtagttaatgatgtggttcgaaatctgcgg
gacaatactactcagtatctagatgtcaatattgaccttttggaagagagtaatggggag
cttctcggagtcagcattacctttactgatgttacccgttatcatgaccttcaagtggaa
cttcagcgagctaaccaagaactagaaaccgctaatgaagagttacagtcttctaatgaa
gaattagaaaccactaacgaagaactccaatctaccaatgaagaattagaaaccactaac
gaggaactgcaatctaccaatgaagaactcgagacgatgaatgaagaactgcaatctact
aatgaggaactacaaaccattaatgatgaattgcgccagcgcaccacagacctcaatcaa
gccaatgcttttttaaattctatcttggccagtctgcaagcggcggtggtggtggtcaat
cgtcaatttaacatcttaacttggaacgaagaagcggaaaatctgtggggattgaggtct
gaagaggtacaaggggagtcaattttaagcctcgatattggtttgccggttgagcaactg
cgagaacccatccgtaactgtttaagcgcgaccataaatagccaagaaatcttactagaa
gctattaatcgtcgtgggcgaaagattaactgtcgtgtgagttttaatcccctcatcggt
catgaaaaagaacttcaaggagtaattctgctgatggaagaattgacctctgccctcgtt
gaaacagatagctaa

DBGET integrated database retrieval system