KEGG   Cyanothece sp. PCC 7822: Cyan7822_5767Help
Entry
Cyan7822_5767     CDS       T01310                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00010  Glycolysis / Gluconeogenesis
cyj00260  Glycine, serine and threonine metabolism
cyj00680  Methane metabolism
cyj01100  Metabolic pathways
cyj01110  Biosynthesis of secondary metabolites
cyj01120  Microbial metabolism in diverse environments
cyj01130  Biosynthesis of antibiotics
cyj01200  Carbon metabolism
cyj01230  Biosynthesis of amino acids
Module
cyj_M00002  Glycolysis, core module involving three-carbon compounds
cyj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7822_5767
  Energy metabolism
   00680 Methane metabolism
    Cyan7822_5767
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan7822_5767
Enzymes [BR:cyj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cyan7822_5767
Membrane trafficking [BR:cyj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Cyan7822_5767
Exosome [BR:cyj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cyan7822_5767
  Exosomal proteins of melanoma cells
   Cyan7822_5767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADN17628
UniProt: E0UKZ8
Position
Cy782201:229223..229924
Genome map
AA seq 233 aa AA seqDB search
MAKLILLRHGQSLWNAANKFTGWVDIPLSEQGRAEAMIASCKLRAHNYRIDMCFTSMLFR
AMETAVICLTECDEICGNKIPIFKHDATDPNWHGWDKYEGNGEDELPIFPTVALDERYYG
DLQGLNKQETAEKYGKYQVQEWRRSFNVRPPGGESLEDTLKRTLPFFQEHILKQVTQGNN
VLIAAHGNSLRSIIMSLENIPEQEIPHLELATGVPIVYDIDVTGKMTRKLILN
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggctaaactaattttattaagacatgggcaaagcctttggaacgctgccaacaagttt
accggttgggtagacattcctttaagcgaacaaggacgggccgaggcaatgatcgcttct
tgcaaacttagggcacataactatcgtattgatatgtgcttcacgagtatgctatttaga
gcgatggaaactgcggttatttgtttaactgagtgtgatgaaatttgtggcaataaaatt
cctatatttaaacatgatgcaacggaccctaattggcacggttgggacaagtatgaaggc
aatggtgaagacgaattacctatttttccaactgtggctttagatgaacgttattatgga
gacttacaaggattaaacaaacaagaaacagccgaaaaatatggtaaatatcaagtgcaa
gaatggcggcgttcctttaatgtacgtccacctggcggcgaaagtttagaggataccctt
aagcgtaccttacccttttttcaagaacatattcttaaacaggttacacaaggaaacaat
gttttaattgccgctcatggtaactctttgcgttccatcattatgagtttagaaaatatt
cctgagcaagaaattcctcatcttgagttagctactggtgttcccatcgtttatgatatt
gatgtcaccggcaaaatgacccgtaaactcattttaaactaa

DBGET integrated database retrieval system