KEGG   Cyanobacterium sp. HL-69: AA637_04055Help
Entry
AA637_04055       CDS       T05309                                 

Definition
(GenBank) putative hydrolase of the HAD superfamily
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
cyl  Cyanobacterium sp. HL-69
Pathway
cyl00010  Glycolysis / Gluconeogenesis
cyl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AA637_04055
Enzymes [BR:cyl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     AA637_04055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Carbpep_Y_N
Motif
Other DBs
NCBI-ProteinID: AUC60388
UniProt: A0A2K8WMS2
Position
883945..884595
Genome map
AA seq 216 aa AA seqDB search
MFISKIDYEQLDAIIFDLGGVIIEVDMGYPYDYFAQHTSEDKDILIEDLRAIALGYEIGK
IGDEEFINQVKETTKLNKTDEDIKIIWNGMLGQVPSKLGKLLHKIKQEKKTFILSNTNPI
HIEEVEKRFKQSIPEYPLETLFDKIYYSYEIGLHKPDQKIFEYIIKAHNLIPHRTLFIDD
NIHNVNSAKKLGLQTIHMNPPMNLPHVFSSLYQENK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtgtttatatctaaaatagattacgaacaattagacgctattattttcgatttgggggga
gttattatcgaggttgatatgggttatccctatgattattttgctcaacatacttcagag
gataaagatattttaattgaagatttaagggcgatcgcccttggctacgaaataggaaaa
ataggagatgaagaatttattaatcaagtaaaagaaactaccaaattaaataaaactgac
gaagacataaaaataatttggaatgggatgttagggcaagtaccatcaaaattagggaaa
ttattacataaaatcaaacaagagaaaaaaacctttattttaagcaatacaaaccctatc
catatagaagaagtagaaaaaagatttaaacaatccattccagaatatcccctagaaaca
ttattcgataaaatttactactcctatgaaataggattacataaaccagaccaaaaaata
tttgaatatataatcaaagcccataacctaataccccatcgcaccctattcatagatgat
aatatccataatgtgaatagtgccaaaaagttaggcttacaaacaatacacatgaatccc
cccatgaatttaccccatgtcttttcttctctctaccaagaaaataaataa

DBGET integrated database retrieval system