KEGG   Cyanobacterium sp. HL-69: AA637_07000Help
Entry
AA637_07000       CDS       T05309                                 

Definition
(GenBank) putative amidohydrolase Nit
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
cyl  Cyanobacterium sp. HL-69
Brite
KEGG Orthology (KO) [BR:cyl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AA637_07000
Enzymes [BR:cyl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     AA637_07000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AUC60916
UniProt: A0A2K8WPQ9
Position
1463322..1464140
Genome map
AA seq 272 aa AA seqDB search
MKSYLAAAVCMTSTPDVEANLNQAEELIELAVNQGAKLIGLPENFSFLGRDEEKIAQVET
IATKSEKFLIRMAQRFQVTILGGGFPTPLEGDRTKAYNTAMLVDANGTALGCYHKTHLFD
VNVPDGNNYQESKTVMAGDDLPPVCGTEDLGKIGLSICYDVRFPEVFRHLSRQGAEVMFI
PAAFTAYTGKDHWQVLLQARAIENTCYVVAPAQTGNHYARRCSHGHAVIVDPWGSIIAST
GSQIGVAIGEINPQRLQQVRLQMPSLQHRVFS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatatttggcggcggcagtttgcatgacaagcactcctgatgtggaggcaaat
ctcaatcaggcagaagagttaatcgagttggcagttaatcagggggcgaagttgattggc
ttgcctgaaaatttctcttttttaggtagagatgaagaaaaaattgcccaagtggaaact
attgccaccaaaagcgaaaagtttttgattcgtatggcccagcgttttcaggttactatc
cttgggggtggttttcctactccccttgagggcgatcgcactaaggcatataatacagct
atgctagtggatgctaacggtacggcattgggctgttatcacaagacacacctattcgat
gtcaatgtacctgatggtaacaattatcaagaatcaaaaaccgtcatggcaggggatgac
ttaccccccgtatgtggcactgaagacttaggaaaaatagggctttccatctgttacgat
gttcgttttcccgaggtgtttcgtcacctttcccgtcaaggggcagaagttatgtttatt
cctgcggcctttactgcctatactggaaaagaccattggcaggtattattacaagcaagg
gccatcgaaaatacttgttatgtggtagccccagcccaaacaggaaatcattatgcccgt
cgttgtagccatggccatgcggtaatagtagatccttggggtagtataatcgctagtacc
ggctctcaaattggggttgccatcggtgagattaatcctcagcgtttacaacaggtgcgt
ttacagatgcctagtttacaacatcgggtttttagttaa

DBGET integrated database retrieval system