KEGG   Cyanobacterium sp. HL-69: AA637_08645Help
Entry
AA637_08645       CDS       T05309                                 

Gene name
phhB
Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
cyl  Cyanobacterium sp. HL-69
Pathway
cyl00790  Folate biosynthesis
cyl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AA637_08645 (phhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cyl04147]
    AA637_08645 (phhB)
Enzymes [BR:cyl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     AA637_08645 (phhB)
Exosome [BR:cyl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AA637_08645 (phhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AUC61225
UniProt: A0A2K8WQ83
Position
1827861..1828133
Genome map
AA seq 90 aa AA seqDB search
MLLDQQQINQKLESLKSWTIEGKKLVKTFKFEDFIKAIDFVNKLVSPAESAGHHPDILIS
YNKVTINLTTHDEGGLTQKDFDLAQEITNL
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgctattagatcaacaacagattaatcagaaattagaaagcctaaaatcatggactatc
gaaggtaaaaaactcgttaaaacctttaaatttgaggacttcataaaggcgatcgacttt
gtcaacaagttagttagccccgccgaatccgcaggacaccacccagatatattgatctcc
tacaacaaagttaccattaatttaaccacccatgatgaaggaggactaacccaaaaagac
tttgatctagcccaagaaataaccaacctgtaa

DBGET integrated database retrieval system