KEGG   Cyanothece sp. PCC 7425: Cyan7425_1152Help
Entry
Cyan7425_1152     CDS       T00836                                 

Definition
(GenBank) acetylglutamate kinase
  KO
K00930  acetylglutamate kinase [EC:2.7.2.8]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00220  Arginine biosynthesis
cyn01100  Metabolic pathways
cyn01110  Biosynthesis of secondary metabolites
cyn01130  Biosynthesis of antibiotics
cyn01210  2-Oxocarboxylic acid metabolism
cyn01230  Biosynthesis of amino acids
Module
cyn_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:cyn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Cyan7425_1152
Enzymes [BR:cyn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.8  acetylglutamate kinase
     Cyan7425_1152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ACL43534
UniProt: B8HLP6
Position
984875..985744
Genome map
AA seq 289 aa AA seqDB search
MLSDSDRVQVLSEALPYLQAFAGRTIVVKYGGAAMKDSNLKDKVIRDIVFMSYVGLRPVV
VHGGGPEINFWLEKLGIEPQFKNGLRVTDAATMEVVEMVLVGRVNKELVSLINTAGGRAV
GLCGQDGNLIRARPQGQDGIGFVGEVQGVDIRLVANLVEKGYIPVISSVAADENGQAYNI
NADTVAGELAAALGAEKLILLTDTAGILRDYHDPSTLIYKLDIQQARELIDQGVVSGGMI
PKVNCCVRSLAQGVRAAHIIDGRLPHSLLLEIFTDSGIGSMIVASEAYL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgctcagtgatagcgatcgcgtccaggtgctcagtgaagccctgccctatttgcaagcc
tttgccgggcgcactattgtggtcaaatacggtggtgccgccatgaaagacagtaatctc
aaggacaaggtgattcgggatattgtcttcatgtcctacgttgggttgcgccctgttgtt
gtgcatggtggggggccggaaatcaatttctggctggaaaagttagggattgaaccccag
ttcaagaatggattgcgggtgacggatgcggcgacgatggaagtcgtagaaatggtgctg
gtggggcgcgtcaataaggaattggtttctctcattaacaccgcgggcggtcgagcagtg
gggctatgtggacaggatggtaatttgattcgggctcgtccccaggggcaggatgggatc
ggttttgtcggcgaagtacagggtgtagacatacgcctggtggccaatctggttgagaaa
ggctacatcccagtgatttctagtgtggcggcagatgaaaatggtcaggcttataacatc
aatgccgatacagtggcgggagaactggccgctgcactgggggcagaaaagttaatcttg
ctaacggatacagctggcattctgcgggattaccacgacccctccacgctgatttacaag
ctggatattcaacaggcccgtgagttgattgaccagggcgttgttagtggtgggatgatt
cccaaagtgaattgctgtgtacgatcgctggctcagggggtacgggccgctcacattatt
gatggtcgtttaccccattctttgctgttggaaatttttactgatagcggaattggttca
atgattgtcgcttcagaggcgtatctttag

DBGET integrated database retrieval system