KEGG   Cyanothece sp. PCC 7425: Cyan7425_1402Help
Entry
Cyan7425_1402     CDS       T00836                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02040  phosphate transport system substrate-binding protein
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn02010  ABC transporters
cyn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cyn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Cyan7425_1402
  09132 Signal transduction
   02020 Two-component system
    Cyan7425_1402
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyn02000]
    Cyan7425_1402
Transporters [BR:cyn02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter
    Cyan7425_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_like_2 PBP_like SBP_bac_11 DZR zf-ribbon_3 zf-RanBP zinc_ribbon_2 ADK_lid
Motif
Other DBs
NCBI-ProteinID: ACL43775
UniProt: B8HNP4
Position
1238267..1239433
Genome map
AA seq 388 aa AA seqDB search
MVNDFNTVTCPKCGHDRNPADAKKCEICGQSLRKGGLPIAPLLIGAFALFVLAGGGYFLF
RALQPQPGSITSTPGQIPSPAPVTPPPPLGKDQLITAANPELYTALAQIPNVPAGTFNYG
GSTTFAPLRSDRVLQAIEQAHPDFRLRYTEPVGDKPGSGTGINMVITGELSFSQSSRPLK
DEELGRAAQRGFKLEQVPVAIDGLAFYVNPQLQIPGLTVAQLREIYAGKVTNWKQVGGPD
LAVVPLSRDPNAGGTVDFFLESVLEKQPLGSAVQIVRDTTTSLRQVAKTPGGIGYATASE
VIGQQTIRPLAIARGGGQSFVSPFAPGDNKTVNEAAIADGSYPLTRRLFIIIKRDGRLDE
QAGVAYTNLLLSKEGQSFVKAAGFTPVR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacgacttcaacactgttacctgtcccaagtgcggtcacgatcgcaatcccgcc
gatgccaaaaagtgtgagatctgtggacaatccctgcggaaaggtggtttgccgattgcc
cccctgctgatcggtgcctttgcgctgtttgttctggctggcggtggttattttctattt
agggcgctgcaaccacaaccaggctccatcacttcgactcccggtcagatccctagccct
gctcccgttactccccctccacccctagggaaagatcaactgatcacggcagcgaaccca
gaactgtatacagccctggcgcagattcccaatgttccggctggcacgtttaactatggt
ggatcaacgacctttgcccccctgcgatcggatagagtgctgcaggcgatcgagcaagcc
caccccgacttcaggttacgctacaccgagcccgtaggagataagcctggctctggcacc
ggcatcaacatggtaattactggggaattgagcttttcccagtcttcccgtccgctcaaa
gatgaagaattgggccgggctgcccagcggggatttaagttagaacaggtgccagtcgcg
atcgatggtctggccttttatgtcaatcctcaactgcaaattccggggttaaccgttgcc
caactgcgggagatttacgcgggtaaggtaacgaactggaaacaggtgggcggccccgat
ctggccgtagttcccctcagccgcgatcccaatgccgggggaacggtggacttttttctc
gaaagtgtcctggaaaagcagcccttaggctcagccgtgcagatcgtgcgggataccaca
accagtctgcgtcaggtggcgaaaacccccggtgggattggctatgcaacggcctcggag
gtaattggccaacaaaccattcgccctctagccattgctcgaggtgggggtcaatccttt
gtctcaccctttgcgccaggggataacaagactgtgaatgaggctgcaatcgccgatggg
tcttacccccttacccgccggttgttcatcattattaaacgggatggacgactggatgaa
caggccggagtggcctataccaatttattactgagtaaagaagggcaaagttttgtgaaa
gctgctggctttaccccagtgcgttaa

DBGET integrated database retrieval system