KEGG   Cyanothece sp. PCC 7425: Cyan7425_3237Help
Entry
Cyan7425_3237     CDS       T00836                                 

Definition
(GenBank) ubiquinone biosynthesis O-methyltransferase
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00130  Ubiquinone and other terpenoid-quinone biosynthesis
cyn01100  Metabolic pathways
cyn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Cyan7425_3237
Enzymes [BR:cyn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     Cyan7425_3237
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     Cyan7425_3237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_12 Ubie_methyltran CMAS PrmA TehB MetW MTS NodS Methyltransf_9 Methyltransf_29 TPMT DREV Methyltransf_8 Methyltransf_15 UPF0020 Cons_hypoth95 PCMT CheR Methyltransf_32 N6_N4_Mtase Methyltransf_18 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACL45564
UniProt: B8HNX7
Position
3203004..3203780
Genome map
AA seq 258 aa AA seqDB search
MIKNDLKYYDLRASTWWEEGQVLHLSNHFNQTRFTYASNHLANWQNCRVLDVGCGGGLAC
EFMARLGARVSGMDRSKNSIQIAQEHAKQSELQINYQQGNAEDLPYQQNSFDCVVCFDVL
EHVYNRNRVISEIYRVLKPGGIFFFDTINRTFQSKLVMIWLLENILRQLPQGLHDWHNFI
QPHELEKILRDLGFIQIELKGFDVTNGGSLKILFQILTQGLKEYHKDGAFPIKLNDDLSV
CYIGKAVKRRKDLVGSQS
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaatgacttgaaatattacgatctccgtgccagcacctggtgggaagagggg
caggttttacatctttccaaccactttaatcaaactcgatttacttatgcatctaatcac
ctggccaattggcaaaactgtagggtgttagatgttggctgtgggggtggcttggcttgc
gaattcatggcccgtttgggagccagagtttcaggcatggatcgatcaaaaaactccatt
cagatcgcccaggagcacgccaaacagagtgagctgcagattaactaccagcaaggaaac
gcagaagatttaccttaccaacaaaacagtttcgattgcgtggtctgtttcgatgtcctg
gagcatgtttataaccgtaacagagtgatctcagaaatttatcgtgtcttaaagccaggt
gggattttctttttcgatacgatcaaccgcacctttcaatccaagctagtcatgatttgg
ttgctggaaaatattctgcggcaactcccccagggcttacatgattggcataattttatc
caaccccatgagttagaaaaaattctgagagaccttggattcattcaaattgaacttaag
ggttttgatgttaccaatggtggcagtctcaaaatacttttccagattctaactcaaggc
ttaaaagagtatcacaaggatggggcattcccgataaaattaaatgatgatctttccgtt
tgctatattggaaaagcagtcaaacgccgaaaagatctggttggctctcaatcgtaa

DBGET integrated database retrieval system