KEGG   Cyanothece sp. PCC 7425: Cyan7425_3291Help
Entry
Cyan7425_3291     CDS       T00836                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00520  Amino sugar and nucleotide sugar metabolism
cyn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cyan7425_3291
Enzymes [BR:cyn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Cyan7425_3291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 Polysacc_synt_2 3Beta_HSD RmlD_sub_bind adh_short KR NmrA UDPG_MGDP_dh_N NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ACL45616
UniProt: B8HP29
Position
complement(3261146..3262111)
Genome map
AA seq 321 aa AA seqDB search
MRILVTGGAGFIGSHLIDRLMEQGHEVICLDNFYTGSKQNLLHWLNHPRFELLRHDVTEP
IRLEVEQIYHLACPASPVHYQYNPVKTIKTNVMGTMNMLGLAKRVKARFLLASTSEVYGD
PEVHPQSEDYRGNVNPIGIRSCYDEGKRVAETLSFDYHRQNNVEIRVARIFNTYGPRMLE
NDGRVVSNFVVQSLKGTPLTVYGDGSQTRSFCYVSDLVEGLMRLMNGDHTGPINLGNPEE
YTVLQLAQKIQGMINPGAEIQFKPLPQDDPQRRKPDITRAKSLLGWQPTIALEDGLERTI
ADFSQRLGGEWVAPSGRYLEV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattctggttacaggtggtgctggcttcattggctctcatcttattgatcggctg
atggagcaggggcatgaggtgatctgtctcgataatttttatacgggtagtaagcaaaat
ctcctgcactggcttaatcaccctcggtttgaactgctgcgccacgatgtgactgagccg
attcgactggaggtggagcagatctatcacctggcctgtcctgcctctccggtgcactat
cagtacaatcccgtcaaaacgatcaaaacgaacgtgatgggaaccatgaatatgttgggg
ttggccaagcgggtcaaggctagatttttgctcgcttctacttcagaggtctatggagat
cccgaagtccatccccaaagtgaagactaccggggaaatgttaacccgatcggcatccgc
tcctgctatgacgaaggcaaaagagttgccgaaaccctctcctttgactatcatcgccag
aataatgtcgaaattcgggtggcacggatttttaatacctatggccctcggatgctagag
aatgatgggcgcgtggtcagtaacttcgttgtccagtcgctcaaaggtacgcccctgacc
gtctatggtgatggcagtcaaacccgcagtttttgctatgtctccgacctggtggaaggc
ttgatgcggctgatgaatggggaccacacgggtccgatcaacctgggaaatccagaggaa
tacaccgttttgcaactggctcaaaaaattcagggaatgattaatccgggggcggaaatt
cagttcaaacccctgccccaggatgacccccaacgccgtaaaccggatattacccgggca
aaatccctactgggatggcaaccgaccattgctttagaggacgggctagagcggacgatc
gccgattttagccagcgcttaggtggggaatgggtggccccgtcaggacgctacctggag
gtttga

DBGET integrated database retrieval system