KEGG   Cyanothece sp. PCC 7425: Cyan7425_3308
Entry
Cyan7425_3308     CDS       T00836                                 

Definition
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00770  Pantothenate and CoA biosynthesis
cyn01100  Metabolic pathways
Module
cyn_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cyn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Cyan7425_3308
Enzymes [BR:cyn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     Cyan7425_3308
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig FliS
Other DBs
NCBI-ProteinID: ACL45633
UniProt: B8HPS4
Position
3273647..3274156
AA seq 169 aa
MIAVYPGSFDPITLGHLDVIERGCKLFETVVVAVSKNPNKIPLFTVEQRIQQIRTCTLHL
ANVEIDAFHGLTVSYAKMRQAQVLLRGLRAVSDFEYELQMAHTNKSLYPQIETVFLTTAN
EYSFLSSSQVKEIARFGGSVAHLVPANVAIDLEKCFAQTPTVSTPIAQD
NT seq 510 nt   +upstreamnt  +downstreamnt
atgatcgcagtctatcccggcagcttcgacccgattactctgggacatctggatgtgatc
gaacgaggctgtaaactgtttgaaactgtggtcgtagcggtgtcaaaaaatcctaacaag
atccccctgtttacagtggaacaacggatacagcaaatccgcacctgcacccttcatctg
gccaacgtggaaatcgatgccttccacggcttaacggtttcctacgccaaaatgcgccag
gcccaggtactcttacggggactcagagccgtttccgattttgagtatgaattgcagatg
gcccataccaacaaaagtctctatccccagatagaaacggtttttttgacaactgctaat
gaatatagtttcctaagtagtagccaggttaaagagattgccaggtttggcggctctgtt
gcccatcttgttcctgccaacgttgccatcgatttagaaaaatgcttcgcccaaactccg
accgtatcaaccccgatcgctcaggactag

DBGET integrated database retrieval system