KEGG   Cyanothece sp. PCC 7425: Cyan7425_3427Help
Entry
Cyan7425_3427     CDS       T00836                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00030  Pentose phosphate pathway
cyn00480  Glutathione metabolism
cyn01100  Metabolic pathways
cyn01110  Biosynthesis of secondary metabolites
cyn01120  Microbial metabolism in diverse environments
cyn01130  Biosynthesis of antibiotics
cyn01200  Carbon metabolism
Module
cyn_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cyn_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cyn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cyan7425_3427
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Cyan7425_3427
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cyn04147]
    Cyan7425_3427
Enzymes [BR:cyn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Cyan7425_3427
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Cyan7425_3427
Exosome [BR:cyn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Cyan7425_3427
  Exosomal proteins of colorectal cancer cells
   Cyan7425_3427
  Exosomal proteins of bladder cancer cells
   Cyan7425_3427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ACL45751
UniProt: B8HQT0
Position
complement(3379789..3381318)
Genome map
AA seq 509 aa AA seqDB search
MVTLLENPLRVGLQQERVPEPTIVVFYGASGDLVKRKLVPALYHLKRERRLPPEFTIVGV
ARREWSHDYFREQMREGIEAYSDGIGSEDLWRNFADGLFYCPGNMDDPQSYQKLNELLLE
LDQQRGTRGNRVFYLSVAPNFFPEAIRQLGAAGMLADPLKTRLVIEKPFGRDLSSAQALN
RVVNQVCQENQVYRIDHYLGKETVQNLLVFRFGNAIFEPLWNRQFVDHVQITVAETVGVE
DRAGYYESAGALRDMVQNHLMQLLCLTAMEPPNSLDADSIRTEKVKAIQAMHLPDVNRLE
FSAVRGQYSAGWMKGKPVPGYREEPGVNPESTTPTYVAMKLVIDNWRWQGVPFYLRTGKR
LPKKVTEISIQFREVPYLIFQSAAQQANPNVLTMRIQPNEGISMRFEVKMPGSSLRTRPV
EMDFRYGTSFGVSGGEAYDRLLLDCMMGDQTLFTRSDEVEAAWRVVTPALLAWDAPSDPA
LIPQYEAGTWEPAEAELLLNRDGRRWRRL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggttaccctgctagaaaatcccctgcgtgtcggtctccaacaggagcgcgttccagaa
cccacgatcgtcgttttctatggcgcgtccggcgatctggtcaaacgcaaactggttcca
gccctctatcacctcaaacgggaacgccgcttacccccggagttcacgatcgtcggtgtg
gcccggcgggagtggagccatgattactttcgtgaacagatgcgcgagggcattgaagct
tattccgatgggattggctccgaagacctctggcgcaactttgccgacggactcttttac
tgtcccggtaacatggatgacccccagagctaccagaagctaaacgagcttttactggag
ttagatcagcagcggggcacgcggggtaaccgggtgttttatctgtctgtcgcccccaac
tttttcccggaagccatccgccaattaggggccgcggggatgctggccgatccgcttaaa
acccgtctggtgattgaaaaaccctttggtcgggatctgagttcagcccaggccctcaac
cgggtggtgaatcaggtctgccaggaaaaccaggtctaccggattgaccactacctcggt
aaggaaacggtgcagaacctgctggtcttccgctttggcaatgccatctttgaacccctg
tggaatcgccagttcgttgaccacgttcagatcacggtggcggaaaccgtgggggtggaa
gatcgggccggttactatgaatcggctggggccttgcgggatatggtgcagaaccacctg
atgcaactgctctgtctaaccgcgatggaaccccccaactccctggatgccgatagtatc
cgcaccgaaaaggtgaaggcgatccaggccatgcatctgccggatgtgaatcgtctagaa
ttttctgcagtgaggggacagtattcggcgggctggatgaaaggtaaacctgtcccaggt
tatcgggaagaaccgggagtcaatcctgaatcgaccacgccaacctatgtggccatgaag
ctggtgatcgacaactggcgctggcagggggtccccttctatctccgtacgggcaagcgg
ctaccgaaaaaagtgacggaaatttcgatccaattccgtgaagttccctatctgatcttt
cagtccgccgcccagcaggctaaccccaatgtgctaacgatgcggattcagcccaacgaa
ggcatttccatgcggtttgaagtcaaaatgcccggctccagtttacgcacccgcccggtg
gagatggattttcgctatggcacgtcctttggggtgtccggtggagaagcctacgatcgc
cttctgctcgactgtatgatgggcgaccagaccctctttacccgctcggatgaagtggaa
gcggcctggcgggtggttacaccggcattactggcctgggatgccccctccgatccggcc
ttgatcccccagtacgaagcgggcacctgggaaccggcagaagcggaattgctgctgaac
cgggatggtcgtcgttggcgcagactctaa

DBGET integrated database retrieval system