KEGG   Cyanothece sp. PCC 7425: Cyan7425_3762Help
Entry
Cyan7425_3762     CDS       T00836                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00240  Pyrimidine metabolism
cyn00250  Alanine, aspartate and glutamate metabolism
cyn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cyan7425_3762
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cyan7425_3762
Enzymes [BR:cyn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Cyan7425_3762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace DUF4431 ComA
Motif
Other DBs
NCBI-ProteinID: ACL46081
UniProt: B8HTK0
Position
3757203..3758174
Genome map
AA seq 323 aa AA seqDB search
MATSWHRRHVLSLADFTAEEFNTVLQSANSFREVLTRRTKKVPTLQARVVANLFFESSTR
TRNSFELAAKRLSADILNFSPGTSALSKGETILDTAKTFWAMGADFMVVRHRESGVPQAI
AAEMDQLGGQVGILNAGDGCHEHPSQGLLDLFTLCTLLDPEQPRLELLAGKKIAIVGDLL
HSRVARSNLWSFKAAGAEVHLAGPPTLLPQEFQQYGAQLHWQLEPALDQADFVMTLRLQK
ERMSQHLIPSLREYHQQFGLTTERLKHCQPHVKVLHPGPVNRGVEISSELMDDPRLSLIS
QQVTNGVAVRMALLYLMSGGGKG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctacgtcttggcatcgccgccacgttctttccctggctgattttacagcggaagaa
ttcaacacggttttacaatctgcaaatagttttcgagaagttttaacccgtcgcaccaaa
aaagtgcccacgttgcaagcccgagtggtggccaacttgttttttgagtcttccacccgc
acccgcaatagttttgaactggcggccaagcgcttatccgccgatattctcaacttttca
ccgggaacctctgccctgagtaagggggaaaccattctggatacagcaaaaaccttctgg
gccatgggggcggattttatggtggtgcgccatcgggagtcaggagtgccccaggcgatc
gccgctgagatggatcaattagggggccaggtgggaattctcaatgccggggatggttgc
catgaacatccgtcccaggggttgctggatttatttaccctctgtaccctgttggacccg
gagcaacctcgcctggaactgttagcgggtaagaaaattgcgatcgttggcgatctatta
cattcgcgggtggcccgatcgaatctctggagcttcaaagcggcgggagcagaggttcac
ctggctggtcctccaaccctgctaccccaggaatttcaacagtatggcgcccaactgcac
tggcaattagagccggccttagaccaggcagattttgtcatgaccctgcggctgcagaaa
gaacggatgagccagcatttaattcccagtttgcgagagtatcatcagcagtttggtctg
accaccgagcggttaaaacattgccaaccccacgtcaaggttctgcatccgggcccggtg
aatcgcggtgtagagatcagttcagaactgatggatgatccccgtctcagcctgatttcc
cagcaggtgacgaatggggtggcggtgcggatggcgctgttatatctgatgagtggcggt
ggcaaaggttaa

DBGET integrated database retrieval system