KEGG   Cyanothece sp. PCC 7425: Cyan7425_3887Help
Entry
Cyan7425_3887     CDS       T00836                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00010  Glycolysis / Gluconeogenesis
cyn00620  Pyruvate metabolism
cyn00640  Propanoate metabolism
cyn00680  Methane metabolism
cyn01100  Metabolic pathways
cyn01110  Biosynthesis of secondary metabolites
cyn01120  Microbial metabolism in diverse environments
cyn01130  Biosynthesis of antibiotics
cyn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7425_3887
   00620 Pyruvate metabolism
    Cyan7425_3887
   00640 Propanoate metabolism
    Cyan7425_3887
  Energy metabolism
   00680 Methane metabolism
    Cyan7425_3887
Enzymes [BR:cyn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cyan7425_3887
Lipid biosynthesis proteins [BR:cyn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cyan7425_3887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N UCR_6-4kD
Motif
Other DBs
NCBI-ProteinID: ACL46204
UniProt: B8HUK2
Position
complement(3905061..3907034)
Genome map
AA seq 657 aa AA seqDB search
MPQAAIESILQEKRLFYPAPEFAQKAHIQTLEQYQQLCDRAKQDPLAFWAELAQTELHWF
SDWQQVLDWQPPFAKWFVGGKTNIAYNCLDRHLTTARRNKAALIWEGEPGDSRTLTYAQL
HREVCQFANALKHLGVQKGDRVGIYMPMIPEAAIAMLACARIGAPHTVVFGGFSAEALKD
RLVDAQAKVVITADGGWRKDAIVPLKAQVDQALEHGGAACVENVLVVRRTGEPIPMQLGG
RDHWWHELQQLVSADCPAEPMDSEDMLFILYTSGTTGKPKGVVHTTGGYNLYTHVTTKWI
FDLQETDVYWCTADVGWITGHSYIVYGPLSNGATVLMYEGAPRASNPGCFWDVIEKYQVN
IFYTAPTAIRAFIKMGEHLPLARDLSSLRLLGTVGEPINPEAWMWYHRVIGGERCPIVDT
WWQTETGGIMITPLPGAIPTKPGSATLPFPGIQAEVVDLEGQPANSNDGGYLVVKQPWPG
MMRTVYGDPDRFRRSYWEHIPPKDGHYVYFAGDGARQDEDGYFWVMGRVDDVISVAGHRL
GTMEIESALVSHPAVAEAAVVGKPDQLKGEEIVAFVTLEGTHQPSEELKTELKQHVVAEI
GAIARPGEIRFADALPKTRSGKIMRRLLRTLASGSGITSDTSTLEDRSVLDKLREGS
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgccacaggccgcgattgaatcaatcctgcaggaaaaacgacttttctatcctgcccca
gagtttgcgcaaaaggcccatattcaaactctggaacagtatcaacagctttgcgaccga
gccaaacaggaccccctggcattctgggcggaactggctcaaacggaactgcactggttt
tctgactggcagcaggttttagactggcaacctccctttgcgaaatggtttgtggggggc
aaaaccaatattgcttacaactgcctcgatcgccatctcaccactgcccggcgcaataaa
gccgctctgatctgggaaggggaaccgggggatagccgcaccctcacctatgctcagctc
catcgggaagtatgtcagtttgccaatgccctcaagcatttaggggtacaaaaaggcgat
cgggtgggcatttatatgccgatgatcccggaagcggcgatcgccatgctggcctgtgcc
cgaattggagcgccccacacggtggtgtttggtggattcagtgccgaagctctcaaggat
cggttggtggatgcccaggccaaggtagtaattactgcagatgggggctggcgtaaggat
gcgatcgtacccttaaaagctcaggtcgatcaggccctggagcatgggggagccgcctgt
gtggaaaacgtgctcgtggtgcgccgaacgggtgaacccattccaatgcagttgggggga
cgggatcactggtggcacgaattgcagcaactggtctctgccgattgccccgctgaaccg
atggacagtgaagacatgctgttcattctctacacctcaggcacgacgggcaaaccgaaa
ggggtggtgcacaccacggggggctataacctctacacccatgtgacaacaaaatggatc
tttgacctgcaggagacggatgtttactggtgtactgcagatgtgggttggattacggga
cacagttatatcgtctacggtcccctctccaatggtgcaacggtgttgatgtatgagggg
gctccccgcgcttctaaccccggttgcttctgggatgtgatcgaaaaatatcaggtgaat
attttctacactgctcccaccgccattcgtgcctttatcaagatgggggaacacctgccc
ctcgctcgtgatctctcttccctgcgtttgctcggcaccgtgggagaaccgattaacccg
gaagcctggatgtggtatcaccgcgtgattgggggagaacgctgtccaattgtcgatacc
tggtggcagacggaaaccggcgggattatgattacccccctgcctggggccattccgacc
aaacctggctcagccaccctgcctttccctggcattcaggcggaagtggtcgatctggag
ggccaacccgcaaacagtaatgatgggggctacctggtggtgaaacagccctggccggga
atgatgcggacggtttatggcgatcccgatcggttccggcgcagctactgggaacacatt
ccacccaaggatggccactacgtttactttgctggggatggggccagacaggatgaggat
ggttacttctgggtaatgggtcgggtcgatgatgtgatcagcgtggcgggtcaccgactg
ggcaccatggaaattgagtcggctctggtctcccatccggcggtggcggaagctgcggtg
gttggtaagcccgatcagctcaagggtgaggagattgtcgcctttgtcaccctcgaaggt
acgcaccagcccagcgaggaactgaaaacggaactgaaacagcacgttgtggccgaaatt
ggggcgatcgcccgtccgggtgaaattcgctttgccgatgcactgcccaaaacccgttcc
ggcaaaatcatgcggcggttattacgcaccttagcgagtgggtcaggcattaccagtgat
acctctaccctggaagaccgctccgtcctggataaattgcgggagggctcctga

DBGET integrated database retrieval system