KEGG   Cyanothece sp. PCC 7425: Cyan7425_4182Help
Entry
Cyan7425_4182     CDS       T00836                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cyan7425_4182
DNA repair and recombination proteins [BR:cyn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Cyan7425_4182
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cyan7425_4182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_8 HHH_3 IMS_HHH DNA_pol_lambd_f Cdd1
Motif
Other DBs
NCBI-ProteinID: ACL46495
UniProt: B8HXF0
Position
4233115..4233732
Genome map
AA seq 205 aa AA seqDB search
MSTVYTRPLARLIEQLQRLPGVGPKTAQRLALHLLKRPDSEVQALAQALLEAKQQVGLCS
VCFHLSAEPVCEVCRAPSRDEGTLCVVADSRDVIALEKTREYHGKYHVLGGLISPMEGIG
PEQLHIQPLIQRVSQTAVEEVIMAISPSIEGETTTLYIAQLLKPLTKLKGAKVTRIAFGL
PMGGDLEYADEVTLARALEGRRELD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgtttatacccgtcccctggcccgcttaatcgaacaactgcaacgactaccg
ggggtagggcccaaaacggcacaacgcctggctttacatctgctcaaacgacccgattcg
gaagtgcaggctttagcccaagctttactggaagccaaacaacaggtgggcttgtgttcc
gtttgtttccatctgtccgccgaaccggtttgtgaagtctgccgtgcccccagccgggat
gagggaaccctctgcgtcgtggcagactccagagatgtgatcgccttagaaaaaacccgt
gagtatcacggcaaatatcatgttctgggtggtctgatttcgcccatggaagggataggg
ccggaacaactccacatccaacccctgatccagcgggtcagtcagactgcggtggaagaa
gtgatcatggcgatcagtcccagtattgaaggggaaaccaccaccctctacattgcccaa
ctgctcaagcctttgaccaaactgaagggggctaaagtcacccggattgcctttggattg
ccgatggggggggatttggaatatgccgatgaagtcaccctggcccgcgctctggaagga
cggagagagctagattaa

DBGET integrated database retrieval system