KEGG   Cyanothece sp. PCC 7425: Cyan7425_4503Help
Entry
Cyan7425_4503     CDS       T00836                                 

Definition
(GenBank) VacB and RNase II family 3'-5' exoribonuclease
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cyn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Cyan7425_4503
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cyn03019]
    Cyan7425_4503
   03016 Transfer RNA biogenesis [BR:cyn03016]
    Cyan7425_4503
Enzymes [BR:cyn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     Cyan7425_4503
Messenger RNA biogenesis [BR:cyn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     Cyan7425_4503
Transfer RNA biogenesis [BR:cyn03016]
 Prokaryotic Type
  tRNA degradation factors
   Cyan7425_4503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB CSD2 S1 OB_Dis3
Motif
Other DBs
NCBI-ProteinID: ACL46813
UniProt: B8HK63
Position
complement(4574756..4577050)
Genome map
AA seq 764 aa AA seqDB search
MELSIKNLLDNFADDKLVAPKVLEKKMGCEDDPANLHQLQIALDALERVGILVKERGKYR
RVKDENLVEGKLRCSSKGFCFAIQDDDSSEDIYIRESQLSNAWNGDRVLVQVTKEGRRRR
SPEGEVRLILERGNPSVLARVRRLEQGWRGKPLDDRLLFELELLPSEAVTDLELAEEQLV
HVEIVRYPLGQYPPLGKITQILGNDAQSAADTELVCCKYGLNRNFSEAVRTVAASLPSKL
KKTDLKNRLDLRSLLTLAITDELPGSAFVDAAFSLVQTPTGDWQLGVHIADVSHYVTPDS
PLDREASRRGTTICLRGVTLPLLPESPLGFVPDQERLAVSLLVTLNGAGEVLEYELQPSV
IQVDQILNSAQVQAILTPGEASPEMPPAVTEEVTQLARLSQALHQQRFQRGGFEISLAQA
YLHTYDDEGLLPALTVTPAAIAHSLVAEFLLLANQTIISHLQTLGVPAVYRVQSPPELYD
VQELIKLTGNLGIPLSLSQEDTVQPQDYQNFIRQLATSDVAPLLMELLLETLKPASDSAV
SGPHFSLASVQGYGHFTAPLRRYTDILNHRVLHAIFTEGRDRRSSRSKEQVNLRHSSAVG
EISWNVLPPEIQRELESAITLHLPHLQEREKVALQVMKDLDGLMKVKQMQERTGEVFRGL
ITGIQSYGFFVELEELMVEGLVHVSSLRDDWYEYRSRQQTLIGRKNRRQYRLGDRVEVQV
KNVDYYRQQIDLVVVGGGSEATEEDLEEPGVGPETPSNMEAELE
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggaactttcaattaagaatctgctggacaactttgccgacgataagttagttgccccc
aaggtgctggaaaaaaagatgggctgcgaggatgatccagctaatctgcatcagttacag
atcgctttagatgctttagagcgggtgggcatcctcgtgaaggagcgaggcaagtatcgg
cgggtgaaggatgaaaacctggtggagggcaagctgcgctgctccagtaaggggttttgt
tttgcgatccaggatgatgacagcagtgaggatatctatatccgggaaagccagttgagt
aatgcctggaatggcgatagagtgctggttcaggttacgaaagaaggccgacggcgacgc
agtcctgaaggagaggtgcggttaattctggagcggggaaatccctctgtgctggctcgg
gtgcgacggcttgagcagggctggcggggcaaacccctggacgatcggctgttgtttgaa
ctggaacttctccccagtgaggcggtgacggatctggaactggcagaggagcaactggtt
cacgttgaaattgtccgctatcccctggggcagtatcctcctctgggcaaaattactcag
attttgggcaacgatgcccaatcggcggcagatacggaactggtttgctgtaagtatggc
ttgaaccgtaatttttctgaggcggtgcgaaccgtagcagccagtttacccagcaaattg
aagaaaaccgatctgaaaaatcggctggatttacgatcgctgctgaccctggccattacc
gacgaactcccgggcagtgcctttgtggatgcggccttcagtctggtgcaaacccccacg
ggtgactggcaattgggagtccatattgcggatgtcagccactacgttactcctgatagt
ccccttgatcgggaagccagtcgccggggcaccacgatttgcctccggggagttactctg
cccctgttgcccgaatctcccctgggatttgtgccggatcaggagcgtctggccgtttcc
ctgctggtaacgctcaatggtgcgggggaagtgctggagtacgaactgcagccctcggtg
atccaggtggatcagatcctgaattcagcccaggtccaggcaattttgacccctggcgag
gcttccccagagatgcccccagcggtgacggaagaggtaacgcaactggctcggctcagt
caagcgctccaccagcaacgttttcagcggggagggtttgaaatttctctggctcaggct
tacctgcatacctacgatgacgaaggcttgcttccggctctgaccgttacccccgccgcg
atcgcccactcgttagtggcagagttcctcttgctggccaaccagactatcatttctcac
ctccagaccttaggggtgccagcagtctaccgggtccaatccccgcctgagctttacgac
gtccaggaattgatcaaactgaccggtaatctgggtattccccttagcctcagtcaagag
gataccgttcagccccaggattaccagaactttatccgccagctggctacctccgatgtg
gcccccctgctgatggaattgttgctggagactctcaagcctgccagcgatagtgccgtt
tctggtccccatttcagtcttgcttcggtacagggctatggccatttcaccgccccactg
cgccgctatacggatattctcaaccaccgggtgctgcatgccatttttactgaaggtcgc
gatcgccgcagtagtcgctctaaggaacaggtgaatttgcgccacagttctgctgttggt
gagatcagctggaatgtcctcccccccgaaatccagcgggagttagaatcggccatcacc
ctccatctgccccatctgcaagagcgggaaaaagtggccctgcaggtgatgaaagacctg
gatgggctgatgaaagtcaaacagatgcaggagcgcaccggggaagtgttccgtggttta
attaccggcattcaatcctacggtttttttgtggaactggaagaattgatggtggaaggt
ctggtgcatgtcagctcgctccgggatgattggtacgaataccgctcccgtcagcaaacc
ctgattggacgtaaaaatcggcgtcagtaccgccttggcgatcgagtggaagttcaggtg
aaaaatgttgattactaccgccagcaaattgatctggtagttgtgggtggggggagtgaa
gccaccgaagaagacctggaggaacccggtgttggtccggaaactccctccaacatggaa
gcagaactggagtag

DBGET integrated database retrieval system