KEGG   Cyanothece sp. PCC 7425: Cyan7425_4977Help
Entry
Cyan7425_4977     CDS       T00836                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00010  Glycolysis / Gluconeogenesis
cyn00020  Citrate cycle (TCA cycle)
cyn00620  Pyruvate metabolism
cyn01100  Metabolic pathways
cyn01110  Biosynthesis of secondary metabolites
cyn01120  Microbial metabolism in diverse environments
cyn01130  Biosynthesis of antibiotics
cyn01200  Carbon metabolism
Module
cyn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7425_4977
   00020 Citrate cycle (TCA cycle)
    Cyan7425_4977
   00620 Pyruvate metabolism
    Cyan7425_4977
Enzymes [BR:cyn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cyan7425_4977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl AATase PASTA
Motif
Other DBs
NCBI-ProteinID: ACL47275
UniProt: B8HNE8
Position
complement(5062119..5063417)
Genome map
AA seq 432 aa AA seqDB search
MIHEVFMPALSSTMTEGKIVSWTKSPGDKIAKGETVVIVESDKADMDVESFYEGYLAAIS
TPAGSVAPVGATIGLVAETEAEIAEAQAKVAQQASSAPAPAAETVPSPVATSPVEIKAEP
GLALATPSGRTVASPRARKLAKELNIDLSTLRGSGPHGRIVAEDVEAAAGLVKAAPAIAL
PTAPAPQPNGHRTPTPAVTAPTVAPAVMPGETVPLSTLQQAVVRNMLASLEIPDFHVAYT
LTTDALDQLYKQIKSKGVTMTALLAKAVALTLQKHPIINACYSDGGIQYRANINIAIAVA
MPGGGLITPVLKNADQQDIYSLSRTWKDLVERARAKQLQPDEYTTGTFSLSNLGMYGVDS
FDAILTPGQGAIMAIGAALPQVVATEDGLFGIKRQMKVNITCDHRVIYGADAAAFLQDLA
KLVATDPQALLL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatccatgaagttttcatgcccgcccttagctccaccatgacggaaggtaagattgtc
tcctggacaaaatcccctggggacaaaattgccaaaggggaaacggtggtgatcgtggag
tcagacaaggctgacatggatgtggagtccttctatgagggctatctggctgcgatctcc
acgcctgccggtagtgttgcccccgtcggagccacgatcggtctggttgcggaaacagag
gcagaaattgctgaagctcaggctaaagttgctcaacaagcttcttctgcgccagccccc
gccgctgagacggttcccagtccggttgccaccagcccggttgagatcaaagctgagcct
ggtcttgccctggccacgccttcaggacgcacggtggcttctccccgggcccgcaagctg
gctaaagaactcaacattgatctgagtacgctgcggggaagtggcccccacggtcgaatt
gtggcggaagatgtggaagctgcagcgggattggtcaaagcagccccggcgatcgctcta
cccacggctccggctccccaacccaatggccaccgtacccccaccccagcggttacagct
ccaacggtggctccagcggtgatgcccggcgaaacggttcccctcagcactttgcagcag
gctgtggtgcgcaatatgctggccagtctggagatcccggacttccacgttgcctacacc
ctcaccactgatgcccttgatcagttgtacaagcagattaagtcgaaaggcgtgacaatg
acagcgttactggctaaggccgttgccctgacgctgcaaaagcatccgatcatcaatgcc
tgctatagcgacgggggcattcagtatcgcgccaacattaacattgccattgccgttgcc
atgcccggtgggggtttaattaccccagtgcttaaaaatgctgaccagcaggatatttat
agcctgtcccgtacctggaaagacctggtggagcgggcccgagccaagcaactccagccg
gatgaatacaccaccgggaccttcagcctgtctaatctcggtatgtatggggtggatagt
tttgatgctattctcacccccggtcagggtgcgattatggcgatcggcgctgcccttccc
caggttgtggctacagaagacggcctgtttgggatcaaacggcagatgaaagtgaacatc
acctgtgatcaccgcgtgatctatggtgcagatgccgccgccttcctccaggatctggct
aagctggtagctaccgatccccaggctttattgctctaa

DBGET integrated database retrieval system