KEGG   Cyanothece sp. PCC 7425: Cyan7425_5042Help
Entry
Cyan7425_5042     CDS       T00836                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyn01100  Metabolic pathways
cyn01110  Biosynthesis of secondary metabolites
cyn01130  Biosynthesis of antibiotics
cyn01230  Biosynthesis of amino acids
Module
cyn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyan7425_5042
Enzymes [BR:cyn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cyan7425_5042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh
Motif
Other DBs
NCBI-ProteinID: ACL47339
UniProt: B8HP79
Position
5133457..5134365
Genome map
AA seq 302 aa AA seqDB search
MQIRRRPNPVVAVQELRFQVKAPDATPRNILEEIVWHKEVEVEQMRERAPLLELRKQVQT
APPPRDFVAALRQAQYQPALIAEVKKASPSKGVLREEFDPVAIAQAYATAGAACLSVLTD
EKFFQGSFTYLNQIRQAVHLPLLCKEFIIYPYQMYLARSQGADAVLLIAAILSDQDLQYF
LKIATSLGMAALIEVHTLTELDRVLNLEGVSLVGINNRNLENFTVDLQTTCDLLSKRWDQ
LDQRNILVVSESGLYQAVDLQQVQTAGAKAVLIGESLVKKAADDRFSHETDRMQAKISAL
YS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcgtcgtcgtcccaatccggtcgttgcggttcaggaattgcgctttcaggtc
aaagcccccgatgccacaccccggaacattctggaagaaattgtctggcacaaggaagtg
gaagtggagcagatgcgggagagagctcctttgcttgaactgcgtaaacaggtgcaaaca
gccccccctccccgtgattttgttgccgctttacgacaagctcaataccaaccggccttg
attgcggaagtcaaaaaagcctctcccagtaaaggagttttgcgagaagagtttgatcca
gtggcgatcgcccaagcctatgcaaccgctggagcggcctgtttatcagtgttgacggac
gaaaagttttttcagggcagttttacctatctgaatcaaattcgtcaggctgtccatttg
cccctgctgtgtaaggaatttattatctatccctaccaaatgtacctggcccgcagtcag
ggggccgatgccgtgctgctgattgccgcaattctgtctgatcaggatctgcagtatttt
cttaaaattgccacgagtctgggcatggcggccctgattgaggtgcataccctgacagaa
ctggatcgggtgctgaatctagagggggtcagcctggtggggatcaacaaccgcaatctg
gaaaatttcacggttgatctacaaaccacctgtgacctgctgagcaaacgctgggatcag
ctcgatcaacgcaatattctggtggtgagtgaatcggggctctatcaggcggtggatctg
caacaagtccaaacggctggggccaaagcggttttaatcggtgaatccttagtcaaaaaa
gcggcagacgatcgcttcagccatgagacggatagaatgcaagccaaaatcagtgctctt
tacagttaa

DBGET integrated database retrieval system