KEGG   Citrobacter youngae: CD187_04910Help
Entry
CD187_04910       CDS       T05526                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
cyo  Citrobacter youngae
Brite
KEGG Orthology (KO) [BR:cyo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cyo03016]
    CD187_04910
Enzymes [BR:cyo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CD187_04910
Transfer RNA biogenesis [BR:cyo03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    CD187_04910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AWV25610
UniProt: A0A2U9UDU3
Position
973797..974579
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLSQQFEHHQIQKRYHAIVRGWLMDDAVLDYPLVEELDKIADKFARDDK
GPQPAVTHYRGLATVEMPVATGRYPTTRYGLVALDPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSAAEHFGCQRLMLHASQLALTHPFTGEPLVIRAGLDDVWMQALSQFGWRGLL
PENERVEFSELSGQDEQIDS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaattctttatcaggacgaatggctggtcgccgtcaataaaccttcgggctgg
ttggttcaccgcagttggctcgaccgggatgagaaagtggtggtgatgcaaacggtgcgc
gaccaaattggtcagcacgtatttaccgcccatcgactcgacagaccaacctccggcgtg
ctgctgatgggactgtccagcgaagccgggcgtttgctgtcccagcagtttgaacatcat
caaattcagaaacgctatcatgcgattgtgcgtggctggctgatggatgatgccgtgctg
gattacccgctggtcgaagagctggataagattgccgataagtttgcccgcgatgataaa
ggcccgcagcctgctgtcacccattatcgtggcctggcaacggtagaaatgccggtagcg
accgggcgttatccgactacccgttacgggctggtggcgctggatcctaaaaccggtcgc
aagcaccagctcagacgccatctggcgcacttgcgccatccgattatcggtgacagcaag
cacggtgatttgcggcaaaaccgcagcgccgcagaacatttcggttgccagagattgatg
ctgcatgccagccagcttgcgctgacccatcctttcaccggcgaaccgctggttattcgc
gccggactggatgacgtctggatgcaggcgttatcacagtttggctggcgtggacttctc
cctgagaatgaaagggttgagttcagcgagctgtcaggtcaggatgagcagatagattct
taa

DBGET integrated database retrieval system