KEGG   Citrobacter youngae: CD187_07655Help
Entry
CD187_07655       CDS       T05526                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cyo  Citrobacter youngae
Pathway
cyo00480  Glutathione metabolism
cyo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CD187_07655
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyo02000]
    CD187_07655
Enzymes [BR:cyo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CD187_07655
Transporters [BR:cyo02000]
 Other transporters
  Pores ion channels [TC:1]
   CD187_07655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_4 GST_N_3 GST_N GST_N_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AWV26107
Position
1572845..1573489
Genome map
AA seq 214 aa AA seqDB search
MSKSAITLWSDANFFSPYVLSVYVALQEKGLPFTLKTVDLNSGEHLHPSWQGYALTRRVP
VLGIDGFELSESSAITEFLEESFAPPQWERIYPHDVQKRARARQVQAWIRSDLMPIREER
STDVVFAGVKKGPLSEAGKASAEKLFATASSLLSHGKQNLFGEWCIADCDLALMLNRLVL
NGDEVPEALAEYATFQWQRASVQRFIALSAKRSC
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatctgcaattacgctgtggtcagatgccaattttttctccccctacgtgctg
tctgtttatgtcgctctgcaagagaaggggctacctttcacgctgaaaaccgttgatctc
aatagtggtgaacacttgcatccttcatggcaaggttacgccttgacgcgccgcgtaccg
gttctggggatcgatggttttgaactgagcgaatcatcagcgattacggaattcctggaa
gagagctttgcaccgccacagtgggagcgtatctacccacacgatgtacaaaagcgcgct
cgggcgcgccaggttcaggcgtggatccgcagcgatttaatgcctatccgtgaggaacga
tcaacagatgtcgtttttgctggcgtgaagaaaggaccgttaagcgaagcgggaaaagcc
agtgcggaaaaactgttcgctactgcgagcagtttactgagccacggtaagcagaattta
tttggcgaatggtgtatcgctgactgcgatttagcgctaatgcttaatcgcctggtcctt
aacggcgatgaggttccagaagcgcttgcggaatacgccaccttccagtggcagcgcgct
tcagtacagcgttttatcgcgctttcagcgaagcgttcctgctga

DBGET integrated database retrieval system