KEGG   Citrobacter youngae: CD187_09935Help
Entry
CD187_09935       CDS       T05526                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cyo  Citrobacter youngae
Pathway
cyo00030  Pentose phosphate pathway
cyo00480  Glutathione metabolism
cyo01100  Metabolic pathways
cyo01110  Biosynthesis of secondary metabolites
cyo01120  Microbial metabolism in diverse environments
cyo01200  Carbon metabolism
Module
cyo_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cyo_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
cyo_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:cyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CD187_09935 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CD187_09935 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cyo04147]
    CD187_09935 (zwf)
Enzymes [BR:cyo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CD187_09935 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CD187_09935 (zwf)
Exosome [BR:cyo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CD187_09935 (zwf)
  Exosomal proteins of colorectal cancer cells
   CD187_09935 (zwf)
  Exosomal proteins of bladder cancer cells
   CD187_09935 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AWV26529
Position
2031732..2033207
Genome map
AA seq 491 aa AA seqDB search
MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQINPDTRIIGVGRADWDKAAYTK
VVREALETFMKEKIDESLWETLSGRLEFCNLDVNDTAAFKRLGKMLDQKSRTTINYFAMP
PSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLATSREINDQVGEYFEECQVYRIDHYLG
KETVLNLLALRFANSLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDQAGQMRDMIQNHL
LQILCMIAMSPPSDLSADSIRDEKVKVLKSLRRIDRSNVREKTVRGQYTAGFAQGKKVPG
YLEEEGANKSSNTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVYFKTPELNLF
RESWQDLPQNKLTIRLQPDEGVDIQVLNKVPGLDHKHNLQITKLDLSYSETFNQTHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAMDNDAPKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacgcaaacagcccaggcatgtgatctggtcattttcggcgcgaagggcgac
ctggcgcgacggaaattgctgccttccctgtatcaactggaaaaggccggccagattaac
ccggatacccgcattattggggttgggcgtgccgactgggacaaagcagcctataccaag
gttgtgcgcgaagcgctcgaaaccttcatgaaagaaaaaattgatgaaagtttgtgggaa
accctcagcggtcgtcttgagttttgtaacctggatgtcaacgacaccgccgcgtttaag
cgtctgggcaaaatgctggatcaaaaatcgcgtaccaccatcaactatttcgcaatgccg
ccgagcacctttggcgcgatctgcaaaggtctgggtgaagcaaagctgaatgctaagcct
gcccgcgtggtgatggaaaaaccgctgggtacatcactggcaacatcccgtgaaatcaac
gatcaggttggcgagtatttcgaagagtgccaggtttaccgcatcgaccactatctcggc
aaagagacggtactgaacctgttggcactgcgttttgccaactccctgtttgtgaataac
tgggataaccgcactatcgaccacgtagaaattaccgtggcggaagaagtgggcattgaa
gggcgctggggctactttgaccaggccggtcaaatgcgcgacatgatccagaaccacctg
ctgcagatcctgtgcatgatcgcgatgtctccgccgtccgatctgagcgccgacagcatc
cgtgatgaaaaagtgaaagtactgaaatcactgcgtcgcatcgatcgttcgaacgtacgt
gaaaagacagttcgtggtcagtacaccgccggttttgcccagggcaaaaaagttccggga
tacctggaagaagaaggcgcgaacaagagcagcaacacggaaacgtttgtggcgatccgt
gtggatatcgataactggcgctgggcgggcgtaccgttctatctgcgtaccggtaaacgt
ttaccgaccaagtgctctgaagtggtggtttacttcaaaacgcctgagctgaacctgttc
agagaatcctggcaggacctgccgcagaacaagctgactatccgtttgcagcctgatgaa
ggtgtcgatatccaggtactaaacaaagtgccggggctggatcacaagcataacctgcaa
attaccaaacttgacctgagctactccgaaaccttcaaccaaacgcatctggccgacgct
tatgagcgcctgctgcttgaaacgatgcgcggcattcaggcgctgtttgtgcgtcgagat
gaagttgaagaagcatggaagtgggtcgattctattaccgaagcctgggcaatggacaac
gatgcaccgaagccgtatcaggccgggacctggggaccagttgcctctgtggccatgatt
acccgtgatggtcgttcctggaacgaattcgagtaa

DBGET integrated database retrieval system