KEGG   Citrobacter youngae: CD187_10095Help
Entry
CD187_10095       CDS       T05526                                 

Definition
(GenBank) 23S rRNA (guanine(745)-N(1))-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
cyo  Citrobacter youngae
Brite
KEGG Orthology (KO) [BR:cyo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cyo03009]
    CD187_10095
Enzymes [BR:cyo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CD187_10095
Ribosome biogenesis [BR:cyo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CD187_10095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23 Ubie_methyltran Methyltransf_32 MTS Methyltransf_4 PrmA Methyltransf_29 Methyltransf_8 MetW AdoMet_MTase Methyltransf_9 Methyltransf_2 DLH Pox_MCEL DUF938 CheR PCMT PEGA
Motif
Other DBs
NCBI-ProteinID: AWV26561
Position
2062452..2063261
Genome map
AA seq 269 aa AA seqDB search
MSFSCPLCHQPLTQANNSFVCPGRHQFDVAKEGYVNLLPVQHKRSRDPGDSAEMMQARRA
FLDAGHYQPLRDAIVNVLKEKSTSEDAAILDIGCGEGYYTHAFADALTGCTTFGLDVSKV
AIKAAARRYPQVTFCVASSHRLPFADESMDAIIRIYAPCKAQELARVVKPGGWVITATPG
PRHLMELKGLIYDEVRLHAPHTEQLDGFVLQQSIALGYQMQLQGSEAVALLQMTPFAWRA
KPEVWETLAEKKTFDCQTDFSIHVWQRLN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttcctgtcctctttgccaccagcctcttactcaagcgaataacagttttgtc
tgccccgggcggcaccagtttgacgtggcgaaagaagggtatgtcaacttactgccggtt
cagcataaacgatcgcgcgatccgggtgacagcgctgagatgatgcaggcgcgacgggca
tttcttgatgccgggcactatcaaccgttgcgtgatgcgattgtgaatgtgctgaaagag
aagtcgacttcagaagatgcagcgatcctggatattggctgtggggaagggtattacacc
catgcgtttgccgacgcgctgacgggttgtacaacctttggtcttgacgtctccaaagtg
gcaattaaagctgcagccagacgctatccgcaggtgaccttttgcgttgcctccagccat
cgtctgccgttcgcagatgagtcaatggatgccatcatcaggatctacgcgccctgtaaa
gcgcaagagctggcacgcgtggttaaaccggggggatgggttatcaccgccacgccggga
ccgcgtcatttaatggaactgaaagggcttatttatgatgaggtgcgtttgcatgcgccg
cacacagagcaactggacggttttgttctgcaacagagtattgcgctggggtatcagatg
cagcttcagggcagcgaggccgttgcgttactgcaaatgacgccgttcgcctggcgggca
aagccagaggtgtgggaaacgttagcggagaaaaagacgtttgactgccagaccgacttt
agtattcatgtctggcagcgtctaaattaa

DBGET integrated database retrieval system