KEGG   Citrobacter youngae: CD187_14860Help
Entry
CD187_14860       CDS       T05526                                 

Definition
(GenBank) bifunctional glucose-1-phosphatase/inositol phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
cyo  Citrobacter youngae
Pathway
cyo00010  Glycolysis / Gluconeogenesis
cyo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD187_14860
Enzymes [BR:cyo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     CD187_14860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AWV27419
Position
complement(3010031..3011272)
Genome map
AA seq 413 aa AA seqDB search
MNKSLIATAVAGAVLLSTAAQAQTAPEGYQLQQVLMMSRHNLRAPLANNGSVLEQSTPKQ
WPEWDVPGGQLTTKGGVLEIYMGHYMREWLAEQGMVKSGECPAPNTVYTYANSLQRTVAT
AQFFVTGAFPGCDVPVHHQEKMGTMDPTFNPVITDDSAAFSQQAVQSMEKERSKMQLNDS
YQLLEQMTDYKDSPSCKEKQQCSLTDAKDTFSAKYQQEPGVSGPLKVGNSLVDAFTLQFY
EGFPMDKVAWGEIKSDQQWKVLSKLKNGYQDSLFTSPEVAQNVAKPLVKYIDNALVTERA
KAPKITVLVGHDSNIASLLTALDFKPYQLHDQNERTPIGGKIVFQRWHDSNANRDLMKIE
YVYQSSQQLRNADVLTLKSPAQRVTLELKGCPIDADGFCPIDKFDSVLNEAAK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcgttaatcgccacagccgtggcaggggctgtcttattgtcaaccgccgcg
caggcgcagaccgcgccggaaggctatcagcttcagcaagtattgatgatgagtcggcat
aacttacgcgcacctttagccaataatggcagcgttcttgagcagtccacccccaaacaa
tggccagaatgggatgtccccggcggacaactcactactaaaggcggtgtgctggaaatc
tatatgggccactacatgcgagagtggctggcagagcaggggatggtgaaatcgggcgaa
tgcccggcaccgaacacggtctatacctatgctaacagcctgcagcgtacggtcgccacg
gcgcagttctttgttaccggtgctttccctggttgcgatgttccggtccatcatcaggaa
aaaatgggcaccatggatcccacctttaacccggtgatcaccgatgattccgccgccttc
agccagcaggccgttcagtccatggagaaagagcgcagcaaaatgcagctcaacgatagc
tatcagttgcttgagcaaatgaccgactacaaagactctccgtcctgcaaagaaaaacag
cagtgttccctgaccgatgccaaagatacgtttagcgcgaagtaccagcaggagccaggc
gtttcggggccgctgaaggtgggaaattcgttggttgatgccttcacgctgcaattttac
gaaggcttcccgatggacaaggttgcctggggcgagattaaatcggatcagcagtggaag
gttctgtcgaagctgaaaaacggctatcaggatagcctgttcacctccccggaagtggcg
cagaacgtcgccaaaccactggtgaaatatattgataatgcgctggttactgaacgcgcg
aaagcaccgaaaataaccgtgctggtggggcatgattcaaatatcgcttcgctgctcacc
gcgctggattttaaaccgtaccagcttcacgatcagaacgagcgtacgccgattggcggg
aagattgtcttccagcgctggcatgacagcaatgcaaatcgtgatctgatgaaaatcgag
tatgtgtatcagagctcgcagcagttgcgtaatgcagacgttctgacgctgaaatctccg
gcgcagcgcgtaacgctggagctgaaaggatgtccgatagatgcggatggtttttgcccg
atagataagttcgatagcgtgctgaatgaggcggctaagtaa

DBGET integrated database retrieval system