KEGG   Citrobacter youngae: CD187_17095Help
Entry
CD187_17095       CDS       T05526                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
cyo  Citrobacter youngae
Brite
KEGG Orthology (KO) [BR:cyo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CD187_17095
Enzymes [BR:cyo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     CD187_17095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AWV27823
Position
complement(3445024..3445812)
Genome map
AA seq 262 aa AA seqDB search
MFVAAGQFAVGPSWEKNAETCVLLMSQAAGEGASLLVLPEALLARDDLDPDLSVKSAQLL
EGGFLTRLLRESAQNEMTTILTIHVPSVPGRAFNMLVALRAGQVVAHYAKLHLYDAFSIQ
ESRNVDAGDAIAPLLDVDGLKVGLMTCYDLRFPELALAHALQGAEILVLPAAWVRGSLKE
HHWATLLAARALDATCYLIAAGECGNKNIGQSRVIDPFGVTIAAAAETPALIMAEVSAER
VRQVRAQLPVLSNRRFAPPQLL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttgcagcagggcaatttgccgtgggaccttcatgggaaaaaaatgcagaaacc
tgcgtcttattgatgtcacaggctgcaggagagggggcgtcgctgctggtattaccggag
gcgcttctggcccgtgacgatctggatccagacctgtcagtgaaatcagctcaactgctg
gagggcggatttttgacgcgcttgctgcgagaaagcgcgcaaaacgagatgacgacaatc
ctgacgattcatgttccttctgtgccaggccgggcgtttaacatgctggtggcgctacgg
gcaggtcaggtcgtggcccattacgctaaattacatctctatgatgccttttcgattcag
gagtcacgtaatgttgatgcaggggacgccatagcgccgctgctggacgtagacgggtta
aaagtagggttaatgacctgttatgatctgcgctttcctgagctggcgctggcgcacgca
ttgcagggagcggaaattcttgtcttacccgcagcctgggttcggggatcgcttaaagag
catcactgggctacgcttttggcggcaagagcgttagatgcgacgtgttacctgattgcg
gcgggagagtgcggtaacaagaatatcggccaaagcagggtcatcgacccctttggtgtg
accattgctgctgcggcagaaacgcccgcgctaattatggccgaggtttccgccgagcgg
gtgaggcaggttagggcacaactcccggtgttaagtaaccgacgctttgcgccaccgcaa
ttattatga

DBGET integrated database retrieval system