KEGG   Citrobacter youngae: CD187_18210Help
Entry
CD187_18210       CDS       T05526                                 

Definition
(GenBank) (2E,6E)-farnesyl diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
cyo  Citrobacter youngae
Pathway
cyo00900  Terpenoid backbone biosynthesis
cyo01100  Metabolic pathways
cyo01110  Biosynthesis of secondary metabolites
Module
cyo_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:cyo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD187_18210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:cyo01006]
    CD187_18210
Enzymes [BR:cyo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     CD187_18210
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     CD187_18210
Prenyltransferases [BR:cyo01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CD187_18210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt UbiA
Motif
Other DBs
NCBI-ProteinID: AWV28029
Position
3688815..3689714
Genome map
AA seq 299 aa AA seqDB search
MDFTQQLQACVEQANQALSRFIAPLPFQNTPVVETMQYGALLGGKRLRPFLVYATGQMFG
VSLSTLDAPAAAVECIHAYSLMHDDLPAMDDDDLRRGLPTCHVKFGEANAILAGDALQTL
AFSIISDAPMPEVTDRDRIAMISELAQASGIAGMCGGQALDLEAEGHQVELDALERIHRH
KTGALIRAAVRLGALSAGDKGRECLPILDKYAESIGLAFQVQDDILDVVGDTATLGKRQG
ADQQLGKSTYPALLGLEQAQNKARDLIEDARQSLSLLAAQSLDTSALEALADYIIQRDK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggattttacgcagcagctacaggcttgcgttgagcaagccaaccaggcactgagccgt
tttatcgcgccactgccctttcagaacactcccgtggtagaaaccatgcaatatggcgca
ttattaggcggtaaacgcctgcgcccgttcctggtgtatgcgaccggtcagatgtttggg
gtcagcctgagtacgcttgatgctcccgctgccgccgtcgaatgcattcatgcctattcg
ctgatgcacgatgatttgcccgcgatggatgacgatgacctgcgacgcggtctgccgact
tgccacgtaaaatttggcgaggcaaatgcgatcctggccggagatgcgctacaaacgctg
gcattctccattatcagcgacgccccaatgccggaagtcactgaccgtgaccgcatcgcg
atgatctctgaactggctcaggccagcggcatcgccggtatgtgcggcggtcaggcgctg
gatctggaagctgaaggtcatcaggttgagctggatgcgctggagcggattcaccgccat
aaaaccggagcattgattcgcgccgccgtgcgtttgggggcgttaagtgctggcgataaa
gggcgagaatgcctgccaatactcgacaaatacgcagaaagcatcggtctggctttccag
gttcaggatgacatcctggatgtggtaggcgatactgcaacattgggtaaacgtcagggt
gctgaccagcagcttggcaaaagtacctatcctgcacttctgggtcttgagcaagcccag
aataaagcccgggatttaatcgaggacgcccgccagtcgctaagtctgctggccgcacag
tcactcgatacctcggcactggaagcgctagcggactacataatccagcgtgataaataa

DBGET integrated database retrieval system