KEGG   Citrobacter youngae: CD187_22035Help
Entry
CD187_22035       CDS       T05526                                 

Gene name
phnL
Definition
(GenBank) phosphonate C-P lyase system protein PhnL
  KO
K05780  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnL [EC:2.7.8.37]
Organism
cyo  Citrobacter youngae
Pathway
cyo00440  Phosphonate and phosphinate metabolism
cyo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    CD187_22035 (phnL)
Enzymes [BR:cyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     CD187_22035 (phnL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_16 AAA_33 SMC_N AAA_22 AAA_29 AAA_21 RsgA_GTPase NACHT AAA_30 AAA_23 FtsK_SpoIIIE AAA_25 AAA_14 DUF815 Viral_helicase1 MukB AAA_7 NB-ARC SbcCD_C CPT IstB_IS21 RNA_helicase Septin DAP3 MMR_HSR1 TsaE cobW AAA_28 Gtr1_RagA G-alpha
Motif
Other DBs
NCBI-ProteinID: AWV28725
Position
4509072..4509758
Genome map
AA seq 228 aa AA seqDB search
MNAIRVENVSKTFVLHQQNGVRLPVLQNATLDVKSGECVVLHGHSGSGKSTLLRSLYANY
LPDEGHIHIRHSDEWVDLVQAPARKVLEVRRSTIGWVSQFLRVIPRISALDVVMQPLLDL
GVSREECAAKAANLLTRLNVPERLWHLAPSTFSGGEQQRVNIARGFIVDYPILLLDEPTA
SLDAKNSAAVVALIEEAKARGAAIVGIFHDQTVRDRVADRLHLMGTTA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgatccgcgttgaaaatgtcagtaaaacctttgtcctgcatcagcaaaacggc
gtgcgtctgccggtgctgcaaaacgccactctggacgttaaaagcggcgaatgcgtggtg
ctgcacggtcactcgggcagcggcaaatccacattgctgcgttcgctgtacgccaactac
ctgccggatgaaggacacatccacatccgccacagcgatgaatgggttgatctggtgcag
gccccggcgcgcaaagtactggaagttcgccgttcaaccatcggctgggtgagccagttc
ctgcgcgtgatcccgaggatttccgcgctggatgtggtgatgcaaccgctgctggatctg
ggggtctcccgtgaggagtgtgcagccaaagcagctaacctgcttacccgcctgaacgtg
ccggagcgattgtggcacctggcgccgtcgaccttttccggcggcgaacagcagcgcgtc
aatatcgcccgcgggtttatcgtcgattacccaattctgctgctcgatgagcctaccgcc
tcgctggacgccaaaaacagcgccgccgtcgtcgcattaattgaagaggcgaaagcccgc
ggcgcagccattgtcggcatttttcacgatcaaaccgtgcgcgaccgcgtagcggatcgt
ctgcatctgatgggaacaacagcatga

DBGET integrated database retrieval system