KEGG   Cyanothece sp. PCC 8801: PCC8801_0117Help
Entry
PCC8801_0117      CDS       T00806                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
cyp00250  Alanine, aspartate and glutamate metabolism
cyp00330  Arginine and proline metabolism
cyp01100  Metabolic pathways
cyp01110  Biosynthesis of secondary metabolites
cyp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PCC8801_0117
   00330 Arginine and proline metabolism
    PCC8801_0117
Enzymes [BR:cyp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     PCC8801_0117
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     PCC8801_0117
Transcription factors [BR:cyp03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    PCC8801_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Nif11 LuxC Yop-YscD_ppl
Motif
Other DBs
NCBI-ProteinID: ACK64223
UniProt: B7K0R9
Position
complement(120883..123858)
Genome map
AA seq 991 aa AA seqDB search
MVTQIDANSYENKTQSIARELITQTREKRSLWDKIGDQMRLDDKLMGWAMANPGLRVQLF
HFIDTLPALRSNAEIAHHLQQYLGVESVELPSALKGILNFTDYQSAPAQLAAATVSKSVE
TLAFKYIAGETVQQVIKAVEKLRKEKMAFSIDLLGEAVITESEAKAYFQKYLDLMEELSQ
QSQKWSKVPEIDEADGEALPKVQVSVKLTAFYSQFDPIDPEGSKDKVCAFIRVLLRRAQE
LGVAVHFDMEQYVYKDLTLSILKELLLEEEFLTRTDIGVTLQAYLRDSQQDLHDLIAWAK
QRGYPITIRLVKGAYWDQETIKASQNHWPQPVFNDKAATDINFEQMTQILLENHQYLYAA
IGSHNVRSQAKAIAIAQTLNVPRRAFEMQVLYGMGDQLAKALVKQGYRVRVYAPYGNLLP
GMAYLIRRLLENTANSSFLRQNLEERPVEELIAPPVIKGETEMKEAQKVTFVNAPDTDYS
REVLRERAQKALAKVKDSLGKTYLPLINGEYVQTDVIIDSVNPCNPSEIVGHIGLMSIEQ
AEQALNAAKAAFPAWKKTPATERAKILRKAADLMEERRHELSAWVCLEVGKILQQADAEV
SEAIDFCRYYAAEMERLDAGYSYDIAGETNRYQYQPRGIALVISPWNFPMAIATGMTVAA
LVAGNCTLLKPAETSSVIAAKMVEILVEAGIPKGVIQYVPGKGSQVGAYMVNHPDVHLIA
FTGSREVGCRIYADAAILQPGQKHLKRVIAEMGGKNAIIVDESCDLDQAVAGAVFSAFGY
SGQKCSAASRIIVLDPVYEAFLERFVEATRSLNIGPTDHPSTQVGPVIDATAQKRIQEYI
EIGKQQSTLALQMESPENGYFVGPTIFSNVSPSDTIAQEEIFGPVVAVIRVKNFDEALAV
ANGTDYALTGGLYSRSPEHIERAQNEFEVGNLYINRTITGAIVARQPFGGFKLSGVGSKA
GGPDYLLQFLEPRHITENIQRQGFAPIEGNE
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
ttggtcacacaaattgatgcaaattcctacgaaaacaaaacccaatcaatagcgagggaa
ttaatcacccaaacccgcgaaaaacgctctttatgggataaaatcggcgatcaaatgcgc
ctggatgataaactcatgggatgggcaatggctaacccagggttaagggtacaattattc
cattttattgataccttacccgcattacgcagcaatgccgaaattgctcatcatttacag
caatatttaggagtagaatctgttgaattgccatcagcattaaaaggcattctgaacttt
actgactatcaatctgccccggcacaattagcagcagcaactgtcagtaaatcggttgaa
acattagcctttaaatatatcgcaggagagacggtacagcaggtcatcaaagcagttgag
aagctgcgaaaagaaaaaatggcttttagtattgacctactcggagaagcagttattacc
gaatctgaagccaaagcttactttcaaaagtacctcgacttgatggaagaattatcccaa
caaagtcagaaatggtcgaaggttccagaaatcgatgaagccgatggagaagccttacca
aaagttcaagtttctgtcaaattaacggcgttttattcccaatttgatcccatcgatcct
gaaggaagtaaagacaaagtttgtgcctttattcgagtattattgcgtcgtgcccaagaa
ttaggggttgctgtccattttgatatggagcaatatgtctataaagacctcactttatcg
attctaaaagaattactgttagaagaggaatttctgacgagaactgatattggggtcaca
ttacaagcttatttaagagactcccaacaggacttacatgatttaattgcttgggcaaaa
caacgaggttatcctattacaattagactggtaaaaggagcctattgggatcaagaaacc
attaaagcgagtcaaaatcattggccacaacctgtatttaacgataaagcagcaacagac
atcaattttgaacagatgactcagatattgctagaaaatcatcaatatttgtatgctgct
atcggttcccataacgtccgttcccaagctaaagcgatcgcgatcgcccaaaccctcaat
gtcccgcgtcgtgccttcgagatgcaggtactatatgggatgggggatcaactggcaaaa
gccttagtcaaacaaggctatcgcgtacgggtgtacgccccctacggcaacctcttaccc
ggaatggcctatctcatccgccgtttattggaaaatacggcaaatagttcatttttacgg
caaaacttggaagaaagacctgtagaagaactcattgcgcctcctgtcataaaaggagaa
actgagatgaaagaagcacaaaaagtcacttttgtcaatgcccctgacaccgattattcc
agggaagtcttacgggaaagagcccagaaagccctcgctaaagtcaaagattctctgggt
aaaacctatttacccctgattaacggcgaatacgtccaaaccgatgttattatcgactcc
gttaacccctgcaacccgtcggaaattgtcggacacatcggcttaatgtccattgaacag
gcggaacaagccctaaatgcagcaaaagcagcttttcccgcttggaaaaagacccctgct
accgaaagagcgaaaatcctgcggaaagcggctgatttgatggaagaacgccgtcatgaa
ctttccgcttgggtatgtctagaagtcgggaaaatcttgcaacaagcggatgcagaagtc
tccgaggcgatcgacttttgtcgttattatgccgccgaaatggaacggttagacgcagga
tatagctatgatatcgctggagaaaccaaccgctaccaatatcaacccagaggtattgct
ttggtgatctccccctggaatttccccatggcgatcgctacaggaatgactgtcgctgcg
ttagtagcaggaaattgtaccctactcaaacctgccgaaacatctagcgtcattgccgcc
aaaatggtcgaaattctggtagaagcgggtattcccaaaggcgttattcaatacgtcccc
ggaaagggttctcaagtcggtgcttatatggtcaaccatcctgacgtacatttgatcgcc
tttacgggatcgcgggaagtgggttgtcgcatctatgcagacgcagctattcttcaaccc
ggacaaaaacacctaaaacgggttattgccgaaatggggggcaaaaacgctattattgtc
gatgaaagttgcgatctcgatcaagcggtggcaggggcagtcttttccgcgtttggctat
tccggtcaaaaatgttcggctgcgtcgcgtattatcgtgttagaccccgtttacgaggca
tttctagaacggtttgttgaggccacgcgatcgctaaatatcggacccaccgatcacccc
tctacccaagtcggaccggttatcgatgccacggcgcaaaagcgtattcaggagtacatt
gaaatcggcaaacaacagtcaaccctagcgttacagatggagtctcccgaaaacggctat
tttgtcggccccaccatctttagtaatgtgtcaccatcggataccatcgcgcaagaggag
atttttggtcctgtggttgcagtaatacgggtgaaaaactttgatgaagcgttagcagta
gccaatgggacagactacgctttaactggggggttgtactctcgcagtcccgaacacatc
gaacgagcccaaaatgagtttgaagtaggcaacctgtacatcaatcgtaccattacaggg
gcgatcgtcgctcgtcaaccctttggcggtttcaagctgtctggggtggggtcaaaagca
gggggtcctgactatttgttacagttcctcgaacctcgtcatatcaccgaaaacattcag
cgtcaagggtttgcacccattgaaggcaatgagtaa

DBGET integrated database retrieval system