KEGG   Cyanothece sp. PCC 8801: PCC8801_0454Help
Entry
PCC8801_0454      CDS       T00806                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
cyp00860  Porphyrin and chlorophyll metabolism
cyp01100  Metabolic pathways
cyp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PCC8801_0454
Enzymes [BR:cyp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PCC8801_0454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_16 MCM AAA_22 Sigma54_activat AAA_29 AAA_18 AAA ABC_tran DUF815 AAA_30 AAA_28 AAA_7 tRNA_lig_kinase AAA_PrkA MMR_HSR1 AAA_27 AAA_33 RNA_helicase AAA_19
Motif
Other DBs
NCBI-ProteinID: ACK64550
UniProt: B7JUH0
Position
463964..465040
Genome map
AA seq 358 aa AA seqDB search
MTATLQAPPKTRRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIEVVANDPFNSDPYDPDLMSDRVRQQLEDNISLQITTKKVTMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSEFDRDP
QKFCDNYQPEQEALQNKLVQAQEILKKATVDYDLRVKISEVCSELDVDGLRGDIVTNRAA
KALAAFEGRTEVTVDDIRRTIVLCLRHRLRKDPLETIDSGYKVTKAFNRVFGLEATEN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaccctacaagcccctccaaaaacccgtcgtgtcgtttttccctttacggct
attgttggccaagaagaaatgaaattggccttgctgctcaacgtcattgaccctaaaatc
ggtggtgtgatgattatgggcgatcgcgggacgggaaaatccaccactattcgtgcctta
gccgacttactgcctgaaatcgaagtcgtggctaacgatcccttcaactccgacccctat
gaccccgacttaatgagcgatcgcgtccgtcaacaactcgaagacaacatctccctacaa
atcaccaccaaaaaagtcaccatggtcgatctgcccctaggagcgacggaagatcgcgtc
tgtggtacgatcgatattgaaaaagccctttcagaaggggttaaagcctttgaacccgga
ttactcgctaaagctaaccggggcatcctctatgttgatgaggtcaacctattagacgat
cacctcgttgatgttctcctcgactcggctgctagtggatggaatacggtagaacgcgaa
ggaatctccattcgccatccagcgcgatttgtcttagtggggtcaggaaaccccgaagaa
ggggaattacgaccccaattactcgatcgctttggaatgcacgcagaaattcacaccgtt
aaagaaccggccttgcgagtgcaaattgtagaacagcgatcggagtttgaccgagatccc
caaaaattctgcgataactatcaaccagaacaggaagccttacaaaataagttggttcaa
gcccaagaaatactcaaaaaagcgacggttgactatgacttacgggtaaaaatttcggaa
gtctgctcagaattggatgtggacggactccggggcgatatcgttaccaaccgcgcagct
aaggcgttagcagcttttgaaggacgaaccgaagtaaccgtcgatgatattcgtcgtacc
attgtcctgtgtttgcgtcaccgactccgcaaagatcccctagaaaccattgactctggt
tacaaagtcactaaggcgtttaaccgagtatttggattagaggcgacagagaattga

DBGET integrated database retrieval system