KEGG   Rippkaea orientalis PCC 8801: PCC8801_0680Help
Entry
PCC8801_0680      CDS       T00806                                 

Definition
(GenBank) transcriptional coactivator/pterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
cyp  Rippkaea orientalis PCC 8801
Pathway
cyp00790  Folate biosynthesis
cyp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PCC8801_0680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cyp04147]
    PCC8801_0680
Enzymes [BR:cyp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     PCC8801_0680
Exosome [BR:cyp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PCC8801_0680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ACK64765
UniProt: B7JXK8
Position
complement(706352..706714)
Genome map
AA seq 120 aa AA seqDB search
MILAVCLSFSAGTPTRGSETFKDAAKLTSGQITQQLKTVPGWQLEGQQLRHTYEFENFVE
AIAFVNLLVNPAESLGHHPDLMINYNRVTVSLSSHDAGGLTQKDFDLAKTISTIYQKKIN
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgattttagcagtttgtctgagttttagtgcaggaactcctactagaggcagtgaaacc
tttaaagacgctgcaaaactaacttcagggcaaattacccaacagttaaaaactgtccct
ggatggcaattggaaggacaacaattgcgccatacctatgagtttgagaattttgttgag
gcgatcgcttttgttaatctgttagtgaacccggctgaaagcttaggacaccatcccgat
ttaatgattaactataaccgagttaccgtcagtttaagcagtcatgatgctggaggactt
acccaaaaagattttgacttagccaaaaccatttctacaatttaccagaaaaaaatcaat
taa

DBGET integrated database retrieval system