KEGG   Cyanothece sp. PCC 8801: PCC8801_0791Help
Entry
PCC8801_0791      CDS       T00806                                 

Definition
(GenBank) light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
cyp00860  Porphyrin and chlorophyll metabolism
cyp01100  Metabolic pathways
cyp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PCC8801_0791
Enzymes [BR:cyp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     PCC8801_0791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MipZ MeaB AAA_24 AAA_25 RNA_helicase NACHT AAA_26 SRP54 AAA_16
Motif
Other DBs
NCBI-ProteinID: ACK64873
UniProt: B7JYK3
Position
complement(825452..826321)
Genome map
AA seq 289 aa AA seqDB search
MTLTLAVYGKGGIGKSTTSCNISTALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTL
QEKDFHYEDIWPEDVIYKGYAGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDV
ILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIAASVREKARTHPLRLAGLI
GNRTSKRDLIDKYIEAVPMPVLEILPLIEDIRVSRVKGKTLFEMTESDPSLDYVCNYYLN
IADQLLAMPEGVVPNDAPDRELFTLLSDFYLNPQTPVKSQEEELDLMMV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgactttaacactggcagtttacggaaaaggcggtatcggtaaatccaccactagctgc
aatatttcgacagcattggcaaaaagaggcaaaaaagtcctacaaattggctgcgatccc
aagcatgacagtacatttaccctaacaggtttccttattcccactattattgataccctg
caagaaaaagacttccattacgaagatatttggccggaagacgttatctataaaggctat
gccggggttgactgcgtggaagcgggaggacctcctgcgggtgcggggtgtggtggctat
gtcgtcggagaaacggttaaattactcaaggaattgaacgcttttgatgagtacgatgtc
atcctctttgatgtgttgggtgacgtggtttgtggtggctttgctgcaccgttgaattat
gccgattattgtttaattgtgacggataatggctttgatgcgctgtttgcggctaaccgt
attgctgcatcagtacgggaaaaggcaagaacccatccgttgcggttggcggggttaatt
ggtaacaggacttctaagcgtgatttaattgataaatatatcgaagctgtgccgatgcct
gtgttagaaattctgccgttaattgaagatattcgggtgtctcgggttaagggtaaaacg
ctgtttgaaatgacagaaagtgatccgtctcttgactatgtttgtaattattatttgaac
attgcggatcaattgttagctatgccggaaggtgtggttccgaatgatgcaccggatcgg
gaattatttactttattgtctgatttctatcttaatcctcaaaccccggttaaatctcaa
gaggaagagttagatctcatgatggtttaa

DBGET integrated database retrieval system